B3GNT3 Antibody (1A2) - Azide and BSA Free

Novus Biologicals | Catalog # H00010331-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1A2

Format

Azide and BSA Free
View all B3GNT3 Primary Antibodies »

Product Specifications

Immunogen

B3GNT3 (NP_055071, 135 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLN

Specificity

B3GNT3 - UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 (1A2)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for B3GNT3 Antibody (1A2) - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: B3GNT3 Antibody (1A2) [H00010331-M01]

Immunocytochemistry/ Immunofluorescence: B3GNT3 Antibody (1A2) [H00010331-M01]

Immunocytochemistry/Immunofluorescence: B3GNT3 Antibody (1A2) [H00010331-M01] - Analysis of monoclonal antibody to B3GNT3 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: B3GNT3 Antibody (1A2) [H00010331-M01] - Detection limit for recombinant GST tagged B3GNT3 is 0.3 ng/ml as a capture antibody.

Applications for B3GNT3 Antibody (1A2) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This product is useful for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: B3GNT3

This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein and contains a signal anchor that is not cleaved. It prefers the substrates of lacto-N-tetraose and lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains and the biosynthesis of the backbone structure of dimeric sialyl Lewis a. It plays dominant roles in L-selectin ligand biosynthesis, lymphocyte homing and lymphocyte trafficking. [provided by RefSeq]

Long Name

UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyl-transferase 3

Alternate Names

B3GALT8, b3Gal-T8, B3GN-T3, B3GNT-3, Beta-1,3-galactosyltransferase 8, Beta-1,3-GalTase 8, Beta-1,3-Gn-T3, Beta-1,3-N-acetylglucosaminyltransferase 3, beta-1,3-N-acetylglucosaminyltransferase bGnT-3, beta3GalT8, Beta3Gal-T8, beta3Gn-T3, Beta-3-Gx-T8, BGnT-3, Core 1 extending beta-1,3-N-acetylglucosaminyltransferase, core1-beta3GlcNAcT, EC 2.4.1, EC 2.4.1.-, HP10328, putative type II membrane protein, TMEM3, TMEM3beta3Gal-T8, transmembrane protein 3, UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 8, UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 8, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3

Entrez Gene IDs

10331 (Human)

Gene Symbol

B3GNT3

UniProt

NP_055071 (Human)

Additional B3GNT3 Products

Product Documents for B3GNT3 Antibody (1A2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for B3GNT3 Antibody (1A2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for B3GNT3 Antibody (1A2) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review B3GNT3 Antibody (1A2) - Azide and BSA Free and earn rewards!

Have you used B3GNT3 Antibody (1A2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies