CACNG1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35094

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CACNG1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 30-110 of human CACNG1 (NP_000718.1).

Sequence:
DHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CACNG1 Antibody - BSA Free

CACNG1 Antibody

Immunocytochemistry/ Immunofluorescence: CACNG1 Antibody [NBP3-35094] -

Immunocytochemistry/ Immunofluorescence: CACNG1 Antibody [NBP3-35094] - Immunofluorescence analysis of SH-SY5Y cells using CACNG1 Rabbit pAb at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
CACNG1 Antibody

Immunocytochemistry/ Immunofluorescence: CACNG1 Antibody [NBP3-35094] -

Immunocytochemistry/ Immunofluorescence: CACNG1 Antibody [NBP3-35094] - Immunofluorescence analysis of L929 cells using CACNG1 Rabbit pAb at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
CACNG1 Antibody

Immunocytochemistry/ Immunofluorescence: CACNG1 Antibody [NBP3-35094] -

Immunocytochemistry/ Immunofluorescence: CACNG1 Antibody [NBP3-35094] - Immunofluorescence analysis of C6 cells using CACNG1 Rabbit pAb at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for CACNG1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:100 - 1:500

Western Blot

1:1000 - 1:4000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CACNG1

L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. This particular gamma subunit is part of skeletal muscle 1,4-dihydropyridine-sensitive calcium channels and is an integral membrane protein that plays a role in excitation-contraction coupling. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes. [provided by RefSeq]

Long Name

Voltage-dependent calcium channel gamma-1 subunit

Alternate Names

CACNLG

Gene Symbol

CACNG1

Additional CACNG1 Products

Product Documents for CACNG1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CACNG1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CACNG1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CACNG1 Antibody - BSA Free and earn rewards!

Have you used CACNG1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies