CCR3 Antibody [Biotin]

Novus Biologicals | Catalog # NBP3-80047

Fc Region Site-Specific Biotinylated Antibody
Novus Biologicals

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG
View all CCR3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YETEELFEETLCSALYPEDTVYSWRHFHTLRMTI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Additional information may be available upon request. The antibody concentration is provided on the individual product label. For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for CCR3 Antibody [Biotin]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Recommended applications and dilutions are based on validated applications from the unconjugated base product NBP1-70338.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

0.1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: CCR3

CKR3, or C-C chemokine receptor type 3, is a G protein-coupled, seven-transmembrane domain receptor protein. The chemokine eotaxin appears to be a highly specific agonist for CKR3, making CKR3 one of the factors responsible for selective recruitment of eosinophils to sites of inflammation (1). It has been shown that more than one chemokine activates CKR3, including eotaxin, RANTES, and MCP-3 (2). Since CKR3 is prominently expressed in eosinophils, it has been named the human eosinophil eotaxin receptor (2,3).

Alternate Names

CCR3, CD193

Gene Symbol

CCR3

Additional CCR3 Products

Product Documents for CCR3 Antibody [Biotin]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CCR3 Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CCR3 Antibody [Biotin]

There are currently no reviews for this product. Be the first to review CCR3 Antibody [Biotin] and earn rewards!

Have you used CCR3 Antibody [Biotin]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies