CNAP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35835

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1250-1350 of human CNAP1 (NP_055680.3).

Sequence:
FGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSTGSRYQPLASTASDNDFVTPEPRRTTRRHP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

157 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CNAP1 Antibody - BSA Free

CNAP1 Antibody

Immunocytochemistry/ Immunofluorescence: CNAP1 Antibody [NBP3-35835] -

Immunocytochemistry/ Immunofluorescence: CNAP1 Antibody [NBP3-35835] - Immunofluorescence analysis of C6 cells using CNAP1 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
CNAP1 Antibody

Western Blot: CNAP1 Antibody [NBP3-35835] -

Western Blot: CNAP1 Antibody [NBP3-35835] - Western blot analysis of various lysates using CNAP1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
CNAP1 Antibody

Immunocytochemistry/ Immunofluorescence: CNAP1 Antibody [NBP3-35835] -

Immunocytochemistry/ Immunofluorescence: CNAP1 Antibody [NBP3-35835] - Immunofluorescence analysis of U2OS cells using CNAP1 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
CNAP1 Antibody

Immunocytochemistry/ Immunofluorescence: CNAP1 Antibody [NBP3-35835] -

Immunocytochemistry/ Immunofluorescence: CNAP1 Antibody [NBP3-35835] - Immunofluorescence analysis of L929 cells using CNAP1 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for CNAP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CNAP1

CNAP1/hCAP-D2 is a regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condensed chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. It may target the condensin complex to DNA via its C-terminal domain (referenced from Swissprot).

Alternate Names

CAPD2, CAP-D2, Chromosome condensation-related SMC-associated protein 1, Chromosome-associated protein D2, CNAP1XCAP-D2 homolog, hCAP-D2condensin complex subunit 1, KIAA0159chromosome condensation related SMC associated protein 1, Non-SMC condensin I complex subunit D2, non-SMC condensin I complex, subunit D2

Gene Symbol

NCAPD2

Additional CNAP1 Products

Product Documents for CNAP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CNAP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CNAP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CNAP1 Antibody - BSA Free and earn rewards!

Have you used CNAP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...