DAAM2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92809

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DAAM2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human DAAM2 (NP_056160.2). MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

123 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DAAM2 Antibody - BSA Free

Western Blot: DAAM2 AntibodyBSA Free [NBP2-92809]

Western Blot: DAAM2 AntibodyBSA Free [NBP2-92809]

Western Blot: DAAM2 Antibody [NBP2-92809] - Analysis of extracts of various cell lines, using DAAM2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.
Immunocytochemistry/ Immunofluorescence: DAAM2 Antibody - BSA Free [NBP2-92809]

Immunocytochemistry/ Immunofluorescence: DAAM2 Antibody - BSA Free [NBP2-92809]

Immunocytochemistry/Immunofluorescence: DAAM2 Antibody [NBP2-92809] - Analysis of L929 cells using DAAM2 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
DAAM2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: DAAM2 Antibody - BSA Free [NBP2-92809] -

Immunocytochemistry/ Immunofluorescence: DAAM2 Antibody - BSA Free [NBP2-92809] - Immunofluorescence analysis of U2OS cells using DAAM2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
DAAM2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: DAAM2 Antibody - BSA Free [NBP2-92809] -

Immunocytochemistry/ Immunofluorescence: DAAM2 Antibody - BSA Free [NBP2-92809] - Immunofluorescence analysis of H9C2 cells using DAAM2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for DAAM2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DAAM2

Alternate Names

dishevelled associated activator of morphogenesis 2

Gene Symbol

DAAM2

Additional DAAM2 Products

Product Documents for DAAM2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DAAM2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DAAM2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DAAM2 Antibody - BSA Free and earn rewards!

Have you used DAAM2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies