DDX24 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35561

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 510-859 of human DDX24 (NP_065147.1).

Sequence:
LTLVHQAPARILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATVETLTETKIHCETDEKDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNLEQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFKKIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKADQQEERRRQKQMKVLKKELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKKTKKPKEPQPEQPQPSTSAN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

96 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DDX24 Antibody - BSA Free

DDX24 Antibody

Immunocytochemistry/ Immunofluorescence: DDX24 Antibody [NBP3-35561] -

Immunocytochemistry/ Immunofluorescence: DDX24 Antibody [NBP3-35561] - Immunofluorescence analysis of U-2 OS cells using DDX24 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
DDX24 Antibody

Immunocytochemistry/ Immunofluorescence: DDX24 Antibody [NBP3-35561] -

Immunocytochemistry/ Immunofluorescence: DDX24 Antibody [NBP3-35561] - Immunofluorescence analysis of C6 cells using DDX24 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
DDX24 Antibody

Immunocytochemistry/ Immunofluorescence: DDX24 Antibody [NBP3-35561] -

Immunocytochemistry/ Immunofluorescence: DDX24 Antibody [NBP3-35561] - Immunofluorescence analysis of L929 cells using DDX24 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
DDX24 Antibody

Western Blot: DDX24 Antibody [NBP3-35561] -

Western Blot: DDX24 Antibody [NBP3-35561] - Western blot analysis of various lysates using DDX24 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for DDX24 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:200 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DDX24

DDX24, also known as ATP-dependent RNA helicase DDX24, is a 96.3 kDa 859 amino acid protein and is involved in unwinding and altering the secondary structure of RNA as a part of the DEAD box protein family. Current research is being conducted with diseases and disorders such as malaria, hepatitis, and immunodeficiency. The protein interacts in the RNA metabolic process pathway with IDO1, RAE1, EIF3E, BCS1L, and MRPL4.

Alternate Names

ATP-dependent RNA helicase DDX24, DEAD (Asp-Glu-Ala-Asp) box polypeptide 24, DEAD box protein 24, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 24, EC 3.6.1, EC 3.6.4.13, S. cerevisiae CHL1-like helicase

Gene Symbol

DDX24

Additional DDX24 Products

Product Documents for DDX24 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DDX24 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDX24 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DDX24 Antibody - BSA Free and earn rewards!

Have you used DDX24 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...