delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free
Novus Biologicals | Catalog # H00006444-M01-100ug
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG1 kappa Clone # 3G10
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
SGCD (NP_000328.2, 114 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ILNDQTKVLTQLITGPKAVEAYGKKFEVKTVSGKLLFSADNNEVVVGAERLRVLGAEGTVFPKSIETPNVRADPFK
Clonality
Monoclonal
Host
Mouse
Isotype
IgG1 kappa
Scientific Data Images for delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free
Western Blot: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug]
Western Blot: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug] - Western Blot detection against Immunogen (34.1 KDa).Immunocytochemistry/ Immunofluorescence: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug]
Immunocytochemistry/Immunofluorescence: delta Sarcoglycan Antibody (3G10) [H00006444-M01-100ug] - Mouse Skeletal Muscle stained by verified customer.ELISA: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug]
ELISA: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug] - Detection limit for recombinant GST tagged SGCD is 0.03 ng/ml as a capture antibody.Applications for delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free
Application
Recommended Usage
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Immunocytochemistry/ Immunofluorescence
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Reviewed Applications
Read 1 review rated 5 using H00006444-M01-100ug in the following applications:
Formulation, Preparation, and Storage
Purification
Protein A or G purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: delta-Sarcoglycan
Alternate Names
35DAG, CMD1L, DAGD, deltaSarcoglycan, LGMD2F, SGCD
Entrez Gene IDs
6444 (Human)
Gene Symbol
SGCD
OMIM
601287 (Human)
UniProt
Additional delta-Sarcoglycan Products
Product Documents for delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free (1)
5 out of 5
1 Customer Rating
Have you used delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: ImmunofluorescenceSample Tested: Mouse skeletal muscleSpecies: MouseVerified Customer | Posted 02/13/2014Delta Sarcoglycan staining in mouse skeletal muscle
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...