delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free

Novus Biologicals | Catalog # H00006444-M01-100ug

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 3G10

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SGCD (NP_000328.2, 114 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ILNDQTKVLTQLITGPKAVEAYGKKFEVKTVSGKLLFSADNNEVVVGAERLRVLGAEGTVFPKSIETPNVRADPFK

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free

Western Blot: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug]

Western Blot: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug]

Western Blot: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug] - Western Blot detection against Immunogen (34.1 KDa).
Immunocytochemistry/ Immunofluorescence: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug]

Immunocytochemistry/ Immunofluorescence: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug]

Immunocytochemistry/Immunofluorescence: delta Sarcoglycan Antibody (3G10) [H00006444-M01-100ug] - Mouse Skeletal Muscle stained by verified customer.
ELISA: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug]

ELISA: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug]

ELISA: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug] - Detection limit for recombinant GST tagged SGCD is 0.03 ng/ml as a capture antibody.

Applications for delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Reviewed Applications

Read 1 review rated 5 using H00006444-M01-100ug in the following applications:

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: delta-Sarcoglycan

delta Sarcoglycan is encoded by this gene is one of the four known components of the sarcoglycan complex, which is a subcomplex of the dystrophin-glycoprotein complex (DGC). DGC forms a link between the F-actin cytoskeleton and the extracellular matrix. This protein is expressed most abundantly in skeletal and cardiac muscle. Mutations in this gene have been associated with autosomal recessive limb-girdle muscular dystrophy and dilated cardiomyopathy. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene.

Alternate Names

35DAG, CMD1L, DAGD, deltaSarcoglycan, LGMD2F, SGCD

Entrez Gene IDs

6444 (Human)

Gene Symbol

SGCD

OMIM

601287 (Human)

Additional delta-Sarcoglycan Products

Product Documents for delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • Name: Anonymous
    Application: Immunofluorescence
    Sample Tested: Mouse skeletal muscle
    Species: Mouse
    Verified Customer | Posted 02/13/2014
    Delta Sarcoglycan staining in mouse skeletal muscle
    delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free H00006444-M01-100ug

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...