DNAJC19 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35489

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DNAJC19 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DNAJC19 (NP_660304.1).

Sequence:
MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DNAJC19 Antibody - BSA Free

DNAJC19 Antibody

Western Blot: DNAJC19 Antibody [NBP3-35489] -

Western Blot: DNAJC19 Antibody [NBP3-35489] - Western blot analysis of lysates from T-47D cells, using DNAJC19 Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
DNAJC19 Antibody

Immunocytochemistry/ Immunofluorescence: DNAJC19 Antibody [NBP3-35489] -

Immunocytochemistry/ Immunofluorescence: DNAJC19 Antibody [NBP3-35489] - Immunofluorescence analysis of Hela cells using DNAJC19 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for DNAJC19 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DNAJC19

Probable component of the PAM complex, a complex required for the translocation of transit peptide-containingproteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperonethat stimulate the ATP-dependent activity

Alternate Names

DnaJ (Hsp40) homolog, subfamily C, member 19, DnaJ homolog subfamily C member 19, homolog of yeast TIM14, mitochondrial import inner membrane translocase subunit TIM14, Tim14, TIMM14TIM14Pam18

Gene Symbol

DNAJC19

Additional DNAJC19 Products

Product Documents for DNAJC19 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DNAJC19 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNAJC19 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNAJC19 Antibody - BSA Free and earn rewards!

Have you used DNAJC19 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies