GAPDH Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56153

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (90%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This GAPDH antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GAPDH Antibody - BSA Free

Western Blot: GAPDH Antibody [NBP2-56153]

Western Blot: GAPDH Antibody [NBP2-56153]

Western Blot: GAPDH Antibody [NBP2-56153] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: GAPDH Antibody [NBP2-56153]

Immunocytochemistry/ Immunofluorescence: GAPDH Antibody [NBP2-56153]

Immunocytochemistry/Immunofluorescence: GAPDH Antibody [NBP2-56153] - Staining of human cell line U-2 OS shows localization to nuclear membrane, plasma membrane & cytosol.
Western Blot: GAPDH Antibody [NBP2-56153]

Western Blot: GAPDH Antibody [NBP2-56153]

Western Blot: GAPDH Antibody [NBP2-56153] - Analysis using Anti-GAPDH antibody NBP2-56153 (A) shows similar pattern to independent antibody NBP2-48721 (B). Theoretical molecular weight: 36 kDa

Applications for GAPDH Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GAPDH

Glyceraldehyde 3-Phosphate Dehydrogenase (GAPDH) is a ubiquitous enzyme involved in glycolysis, converting glyceraldehyde-3-phosphate into 1,3 diphosphoglycerate. This constitutively expressed, homotetramer protein can be found in the nucleus and cytoplasm, and the monomer has a theoretical molecular weight of 36 kDa. Known as a housekeeping gene, GAPDH routinely serves as a control for real-time PCR (RT-PCR) and as a loading control for Western Blots (1-3). In addition to its role in glycolysis, GAPDH has multiple cellular functions including membrane trafficking, transcription activation, apoptosis, DNA repair, and has been implicated in various pathologies such as cancer and neurodegenerative diseases including Alzheimer's and Huntington's (4,5).

References

1) Barber RD, Harmer DW, Coleman RA, Clark BJ. (2005) GAPDH as a housekeeping gene: analysis of GAPDH mRNA expression in a panel of 72 human tissues. Physiol Genomics. 21(3):389-95. PMID: 15769908

2) Jia Y, Takimoto K. (2006) Mitogen-activated protein kinases control cardiac KChIP2 gene expression. Circ Res. 98(3):386-93. PMID: 16385079

3) Godsel LM, Hsieh SN, Amargo EV, Bass AE, Pascoe-McGillicuddy LT, Huen AC, Thorne ME, Gaudry CA, Park JK, Myung K, Goldman RD, Chew TL, Green KJ. (2005) Desmoplakin assembly dynamics in four dimensions: multiple phases differentially regulated by intermediate filaments and actin. J Cell Biol. 171(6):1045-59. PMID: 16365169

4) Sirover MA1. (1999) New insights into an old protein: the functional diversity of mammalian glyceraldehyde-3-phosphate dehydrogenase. Biochim Biophys Acta. 1432(2): 159-84. PMID: 10407139

5) Tristan C, Shahani N, Sedlak TW, Sawa A. (2011) The diverse functions of GAPDH: views from different subcellular compartments. Cell Signal. 23(2):317-23. PMID: 20727968

Long Name

Glyceraldehyde-3-phosphate Dehydrogenase

Alternate Names

G3PDH

Gene Symbol

GAPDH

Additional GAPDH Products

Product Documents for GAPDH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GAPDH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GAPDH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GAPDH Antibody - BSA Free and earn rewards!

Have you used GAPDH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GAPDH Antibody - BSA Free

Showing  1 - 58 FAQs Showing All
  • Q: Do you offer a smaller size for the GAPDH antibodies?

    A: We offer sample sizes for many of our GAPDH loading control antibodies including NB300-221.

  • Q: I need a suitable loading control antibody that I can use in western blot of rat nerve extracts, which do you recommend?

    A: This GAPDH antibody (NB300-221) is a good choice for a loading control antibody and has been cited in over 180 publications and used on rat lysates with good results.

  • Q: I want to know why GAPDH is used as a loading control antibody in WB techniques.

    A: Our GAPDH antibody makes a good loading control because GAPDH is  a housekeeping gene essential to metabolism that is globally expressed in most tissue types and cell lines.

  • Q: I wanted to know which of the two housekeeping genes B-actin or GAPDH can be used for best results. I intend to do an experiment to determine expression of IL-6 and TNF-alpha in liver and kidney tissues.

    A: For homogenized tissue, beta-actin and GAPDH are both fine.

  • Q: I'm looking for a loading control between 24kDa - 65kDa for use in simple western, we tried an actin antibody  we already had but it didn't work. What can you recommend?

    A: Our GAPDH antibody NB300-221 has been validated in simple western and detects around 35 kDa so I think it would be a good choice for a simple western loading control antibody based on your size requirements.

  • Q: We need a loading control antibody for WB working with HeLa cell line, will this GAPDH antibody work for that?

    A: GAPDH is expressed in HeLa cell lines but whether or not it is the best option for a loading control antibody depends on the size of the protein you are interested in. GAPDH antibody is a good choice for low to mid MW targets, as GAPDH detects around 35 kDa.

  • Q: We received GAPDH antibody NB600-502 and there was only about 15µl of antibody in the tube. I was under the impression this should have been 100µl.

    A: The unit size of this product is 0.1 mg with a concentration of 6.7 mg/ml. Hence the volume should be no less than 14.9 ul. 

  • Q: What secondary antibody should I use for visualization of the GAPDH antibody?

    A: This GAPDH antibody is raised in mouse so you would want to use an anti-mouse secondary with the dye of your choice.

  • Q: Do you offer a smaller size for the GAPDH antibodies?

    A: We offer sample sizes for many of our GAPDH loading control antibodies including NB300-221.

  • Q: I need a suitable loading control antibody that I can use in western blot of rat nerve extracts, which do you recommend?

    A: This GAPDH antibody (NB300-221) is a good choice for a loading control antibody and has been cited in over 180 publications and used on rat lysates with good results.

  • Q: I want to know why GAPDH is used as a loading control antibody in WB techniques.

    A: Our GAPDH antibody makes a good loading control because GAPDH is  a housekeeping gene essential to metabolism that is globally expressed in most tissue types and cell lines.

  • Q: I wanted to know which of the two housekeeping genes B-actin or GAPDH can be used for best results. I intend to do an experiment to determine expression of IL-6 and TNF-alpha in liver and kidney tissues.

    A: For homogenized tissue, beta-actin and GAPDH are both fine.

  • Q: I'm looking for a loading control between 24kDa - 65kDa for use in simple western, we tried an actin antibody  we already had but it didn't work. What can you recommend?

    A: Our GAPDH antibody NB300-221 has been validated in simple western and detects around 35 kDa so I think it would be a good choice for a simple western loading control antibody based on your size requirements.

  • Q: We need a loading control antibody for WB working with HeLa cell line, will this GAPDH antibody work for that?

    A: GAPDH is expressed in HeLa cell lines but whether or not it is the best option for a loading control antibody depends on the size of the protein you are interested in. GAPDH antibody is a good choice for low to mid MW targets, as GAPDH detects around 35 kDa.

  • Q: We received GAPDH antibody NB600-502 and there was only about 15µl of antibody in the tube. I was under the impression this should have been 100µl.

    A: The unit size of this product is 0.1 mg with a concentration of 6.7 mg/ml. Hence the volume should be no less than 14.9 ul. 

  • Q: What secondary antibody should I use for visualization of the GAPDH antibody?

    A: This GAPDH antibody is raised in mouse so you would want to use an anti-mouse secondary with the dye of your choice.

  • Q: Do you offer a smaller size for the GAPDH antibodies?

    A: We offer sample sizes for many of our GAPDH loading control antibodies including NB300-221.

  • Q: I need a suitable loading control antibody that I can use in western blot of rat nerve extracts, which do you recommend?

    A: This GAPDH antibody (NB300-221) is a good choice for a loading control antibody and has been cited in over 180 publications and used on rat lysates with good results.

  • Q: I want to know why GAPDH is used as a loading control antibody in WB techniques.

    A: Our GAPDH antibody makes a good loading control because GAPDH is  a housekeeping gene essential to metabolism that is globally expressed in most tissue types and cell lines.

  • Q: I wanted to know which of the two housekeeping genes B-actin or GAPDH can be used for best results. I intend to do an experiment to determine expression of IL-6 and TNF-alpha in liver and kidney tissues.

    A: For homogenized tissue, beta-actin and GAPDH are both fine.

  • Q: I'm looking for a loading control between 24kDa - 65kDa for use in simple western, we tried an actin antibody  we already had but it didn't work. What can you recommend?

    A: Our GAPDH antibody NB300-221 has been validated in simple western and detects around 35 kDa so I think it would be a good choice for a simple western loading control antibody based on your size requirements.

  • Q: We need a loading control antibody for WB working with HeLa cell line, will this GAPDH antibody work for that?

    A: GAPDH is expressed in HeLa cell lines but whether or not it is the best option for a loading control antibody depends on the size of the protein you are interested in. GAPDH antibody is a good choice for low to mid MW targets, as GAPDH detects around 35 kDa.

  • Q: We received GAPDH antibody NB600-502 and there was only about 15µl of antibody in the tube. I was under the impression this should have been 100µl.

    A: The unit size of this product is 0.1 mg with a concentration of 6.7 mg/ml. Hence the volume should be no less than 14.9 ul. 

  • Q: What secondary antibody should I use for visualization of the GAPDH antibody?

    A: This GAPDH antibody is raised in mouse so you would want to use an anti-mouse secondary with the dye of your choice.

  • Q: Do you offer a smaller size for the GAPDH antibodies?

    A: We offer sample sizes for many of our GAPDH loading control antibodies including NB300-221.

  • Q: I need a suitable loading control antibody that I can use in western blot of rat nerve extracts, which do you recommend?

    A: This GAPDH antibody (NB300-221) is a good choice for a loading control antibody and has been cited in over 180 publications and used on rat lysates with good results.

  • Q: I want to know why GAPDH is used as a loading control antibody in WB techniques.

    A: Our GAPDH antibody makes a good loading control because GAPDH is  a housekeeping gene essential to metabolism that is globally expressed in most tissue types and cell lines.

  • Q: I wanted to know which of the two housekeeping genes B-actin or GAPDH can be used for best results. I intend to do an experiment to determine expression of IL-6 and TNF-alpha in liver and kidney tissues.

    A: For homogenized tissue, beta-actin and GAPDH are both fine.

  • Q: I'm looking for a loading control between 24kDa - 65kDa for use in simple western, we tried an actin antibody  we already had but it didn't work. What can you recommend?

    A: Our GAPDH antibody NB300-221 has been validated in simple western and detects around 35 kDa so I think it would be a good choice for a simple western loading control antibody based on your size requirements.

  • Q: We need a loading control antibody for WB working with HeLa cell line, will this GAPDH antibody work for that?

    A: GAPDH is expressed in HeLa cell lines but whether or not it is the best option for a loading control antibody depends on the size of the protein you are interested in. GAPDH antibody is a good choice for low to mid MW targets, as GAPDH detects around 35 kDa.

  • Q: We received GAPDH antibody NB600-502 and there was only about 15µl of antibody in the tube. I was under the impression this should have been 100µl.

    A: The unit size of this product is 0.1 mg with a concentration of 6.7 mg/ml. Hence the volume should be no less than 14.9 ul. 

  • Q: What secondary antibody should I use for visualization of the GAPDH antibody?

    A: This GAPDH antibody is raised in mouse so you would want to use an anti-mouse secondary with the dye of your choice.

  • Q: Do you offer a smaller size for the GAPDH antibodies?

    A: We offer sample sizes for many of our GAPDH loading control antibodies including NB300-221.

  • Q: I need a suitable loading control antibody that I can use in western blot of rat nerve extracts, which do you recommend?

    A: This GAPDH antibody (NB300-221) is a good choice for a loading control antibody and has been cited in over 180 publications and used on rat lysates with good results.

  • Q: I want to know why GAPDH is used as a loading control antibody in WB techniques.

    A: Our GAPDH antibody makes a good loading control because GAPDH is  a housekeeping gene essential to metabolism that is globally expressed in most tissue types and cell lines.

  • Q: I wanted to know which of the two housekeeping genes B-actin or GAPDH can be used for best results. I intend to do an experiment to determine expression of IL-6 and TNF-alpha in liver and kidney tissues.

    A: For homogenized tissue, beta-actin and GAPDH are both fine.

  • Q: I'm looking for a loading control between 24kDa - 65kDa for use in simple western, we tried an actin antibody  we already had but it didn't work. What can you recommend?

    A: Our GAPDH antibody NB300-221 has been validated in simple western and detects around 35 kDa so I think it would be a good choice for a simple western loading control antibody based on your size requirements.

  • Q: We need a loading control antibody for WB working with HeLa cell line, will this GAPDH antibody work for that?

    A: GAPDH is expressed in HeLa cell lines but whether or not it is the best option for a loading control antibody depends on the size of the protein you are interested in. GAPDH antibody is a good choice for low to mid MW targets, as GAPDH detects around 35 kDa.

  • Q: We received GAPDH antibody NB600-502 and there was only about 15µl of antibody in the tube. I was under the impression this should have been 100µl.

    A: The unit size of this product is 0.1 mg with a concentration of 6.7 mg/ml. Hence the volume should be no less than 14.9 ul. 

  • Q: What secondary antibody should I use for visualization of the GAPDH antibody?

    A: This GAPDH antibody is raised in mouse so you would want to use an anti-mouse secondary with the dye of your choice.

  • Q: Do you offer a smaller size for the GAPDH antibodies?

    A: We offer sample sizes for many of our GAPDH loading control antibodies including NB300-221.

  • Q: I need a suitable loading control antibody that I can use in western blot of rat nerve extracts, which do you recommend?

    A: This GAPDH antibody (NB300-221) is a good choice for a loading control antibody and has been cited in over 180 publications and used on rat lysates with good results.

  • Q: I want to know why GAPDH is used as a loading control antibody in WB techniques.

    A: Our GAPDH antibody makes a good loading control because GAPDH is  a housekeeping gene essential to metabolism that is globally expressed in most tissue types and cell lines.

  • Q: I wanted to know which of the two housekeeping genes B-actin or GAPDH can be used for best results. I intend to do an experiment to determine expression of IL-6 and TNF-alpha in liver and kidney tissues.

    A: For homogenized tissue, beta-actin and GAPDH are both fine.

  • Q: I'm looking for a loading control between 24kDa - 65kDa for use in simple western, we tried an actin antibody  we already had but it didn't work. What can you recommend?

    A: Our GAPDH antibody NB300-221 has been validated in simple western and detects around 35 kDa so I think it would be a good choice for a simple western loading control antibody based on your size requirements.

  • Q: We need a loading control antibody for WB working with HeLa cell line, will this GAPDH antibody work for that?

    A: GAPDH is expressed in HeLa cell lines but whether or not it is the best option for a loading control antibody depends on the size of the protein you are interested in. GAPDH antibody is a good choice for low to mid MW targets, as GAPDH detects around 35 kDa.

  • Q: We received GAPDH antibody NB600-502 and there was only about 15µl of antibody in the tube. I was under the impression this should have been 100µl.

    A: The unit size of this product is 0.1 mg with a concentration of 6.7 mg/ml. Hence the volume should be no less than 14.9 ul. 

  • Q: What secondary antibody should I use for visualization of the GAPDH antibody?

    A: This GAPDH antibody is raised in mouse so you would want to use an anti-mouse secondary with the dye of your choice.

  • Q: Do you offer a smaller size for the GAPDH antibodies?

    A: We offer sample sizes for many of our GAPDH loading control antibodies including NB300-221.

  • Q: I need a suitable loading control antibody that I can use in western blot of rat nerve extracts, which do you recommend?

    A: This GAPDH antibody (NB300-221) is a good choice for a loading control antibody and has been cited in over 180 publications and used on rat lysates with good results.

  • Q: I want to know why GAPDH is used as a loading control antibody in WB techniques.

    A: Our GAPDH antibody makes a good loading control because GAPDH is  a housekeeping gene essential to metabolism that is globally expressed in most tissue types and cell lines.

  • Q: I wanted to know which of the two housekeeping genes B-actin or GAPDH can be used for best results. I intend to do an experiment to determine expression of IL-6 and TNF-alpha in liver and kidney tissues.

    A: For homogenized tissue, beta-actin and GAPDH are both fine.

  • Q: I'm looking for a loading control between 24kDa - 65kDa for use in simple western, we tried an actin antibody  we already had but it didn't work. What can you recommend?

    A: Our GAPDH antibody NB300-221 has been validated in simple western and detects around 35 kDa so I think it would be a good choice for a simple western loading control antibody based on your size requirements.

  • Q: We need a loading control antibody for WB working with HeLa cell line, will this GAPDH antibody work for that?

    A: GAPDH is expressed in HeLa cell lines but whether or not it is the best option for a loading control antibody depends on the size of the protein you are interested in. GAPDH antibody is a good choice for low to mid MW targets, as GAPDH detects around 35 kDa.

  • Q: We received GAPDH antibody NB600-502 and there was only about 15µl of antibody in the tube. I was under the impression this should have been 100µl.

    A: The unit size of this product is 0.1 mg with a concentration of 6.7 mg/ml. Hence the volume should be no less than 14.9 ul. 

  • Q: What secondary antibody should I use for visualization of the GAPDH antibody?

    A: This GAPDH antibody is raised in mouse so you would want to use an anti-mouse secondary with the dye of your choice.

  • Q: Do you offer a smaller size for the GAPDH antibodies?

    A: We offer sample sizes for many of our GAPDH loading control antibodies including NB300-221.

  • Q: I need a suitable loading control antibody that I can use in western blot of rat nerve extracts, which do you recommend?

    A: This GAPDH antibody (NB300-221) is a good choice for a loading control antibody and has been cited in over 180 publications and used on rat lysates with good results.

  • Q: I want to know why GAPDH is used as a loading control antibody in WB techniques.

    A: Our GAPDH antibody makes a good loading control because GAPDH is  a housekeeping gene essential to metabolism that is globally expressed in most tissue types and cell lines.

  • Q: I wanted to know which of the two housekeeping genes B-actin or GAPDH can be used for best results. I intend to do an experiment to determine expression of IL-6 and TNF-alpha in liver and kidney tissues.

    A: For homogenized tissue, beta-actin and GAPDH are both fine.

  • Q: I'm looking for a loading control between 24kDa - 65kDa for use in simple western, we tried an actin antibody  we already had but it didn't work. What can you recommend?

    A: Our GAPDH antibody NB300-221 has been validated in simple western and detects around 35 kDa so I think it would be a good choice for a simple western loading control antibody based on your size requirements.

  • Q: We need a loading control antibody for WB working with HeLa cell line, will this GAPDH antibody work for that?

    A: GAPDH is expressed in HeLa cell lines but whether or not it is the best option for a loading control antibody depends on the size of the protein you are interested in. GAPDH antibody is a good choice for low to mid MW targets, as GAPDH detects around 35 kDa.

  • Q: We received GAPDH antibody NB600-502 and there was only about 15µl of antibody in the tube. I was under the impression this should have been 100µl.

    A: The unit size of this product is 0.1 mg with a concentration of 6.7 mg/ml. Hence the volume should be no less than 14.9 ul. 

  • Q: What secondary antibody should I use for visualization of the GAPDH antibody?

    A: This GAPDH antibody is raised in mouse so you would want to use an anti-mouse secondary with the dye of your choice.

Showing  1 - 58 FAQs Showing All
View all FAQs for Antibodies
Loading...