GLI-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56230

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (91%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GLI-1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKS

Reactivity Notes

Mouse 88%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit GLI-1 Antibody - BSA Free (NBP2-56230) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for GLI-1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: GLI-1 Antibody [NBP2-56230]

Immunocytochemistry/ Immunofluorescence: GLI-1 Antibody [NBP2-56230]

Immunocytochemistry/Immunofluorescence: GLI-1 Antibody [NBP2-56230] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Applications for GLI-1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GLI-1

Gli1 was produced against a peptide corresponding to the carboxy-terminal region of the mouse Gli-1 protein. This region is not conserved among other gli family members, namely Gli-2 and Gli-3. Gli was termed by Kinzler et al. (1987) as 'glioma-associated oncogene' amplified in malignant gliomas. Analysis of the cloned gene demonstrates that the gene contains 5 repeats of zinc-finger sequences, which places gli in the family of Kruppel (Kr) zinc finger proteins. Northern analysis reveals that GLI is expressed in embryonal carcinoma cells but not in most adult tissue. GLI has been localized to 12q13-q14.3 by Southern blot analysis. On mouse the gene is located on chromosome 10. In mice, 3 zinc finger transcription factors, Gli-1, Gl-i2 and Gli-3, have been implicated in the transduction of Sonic hedgehog (Shh) signal. In papillary epithelium, shh, gli1 and ptc all follow similar expression patterns. Gli1 expression is central and probably sufficient for tumor development in humans.

Long Name

Glioma-Associated Oncogene Homolog 1 [Zinc Finger Protein]

Alternate Names

GLI1

Gene Symbol

GLI1

Additional GLI-1 Products

Product Documents for GLI-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GLI-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GLI-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GLI-1 Antibody - BSA Free and earn rewards!

Have you used GLI-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies