Glutathione Synthetase Antibody (2S9W7)

Novus Biologicals | Catalog # NBP3-15402

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2S9W7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Glutathione Synthetase (GSS) (P48637). AIAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Glutathione Synthetase Antibody (2S9W7)

Western Blot: Glutathione Synthetase Antibody (2S9W7) [NBP3-15402]

Western Blot: Glutathione Synthetase Antibody (2S9W7) [NBP3-15402]

Western Blot: Glutathione Synthetase Antibody (2S9W7) [NBP3-15402] - Western blot analysis of extracts of various cell lines, using Glutathione Synthetase (GSS) Rabbit mAb (NBP3-15402) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Glutathione Synthetase Antibody (2S9W7)

Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody (2S9W7) [NBP3-15402] -

Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody (2S9W7) [NBP3-15402] - Immunofluorescence analysis of NIH-3T3 cells using Glutathione Synthetase (GSS) Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for Glutathione Synthetase Antibody (2S9W7)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Glutathione Synthetase

Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage byfree radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as ahomodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion ofgamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.(provided by RefSeq)

Alternate Names

EC 6.3.2.3, Glutathione synthase, glutathione synthetase, GSH synthetase, GSHS, GSH-S, MGC14098

Gene Symbol

GSS

Additional Glutathione Synthetase Products

Product Documents for Glutathione Synthetase Antibody (2S9W7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glutathione Synthetase Antibody (2S9W7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glutathione Synthetase Antibody (2S9W7)

There are currently no reviews for this product. Be the first to review Glutathione Synthetase Antibody (2S9W7) and earn rewards!

Have you used Glutathione Synthetase Antibody (2S9W7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...