GMEB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55657

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (94%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GMEB1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: STLGNMTTMVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETELRTEEKVVAEMEEHQHQVHNVEI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GMEB1 Antibody - BSA Free

Western Blot: GMEB1 Antibody [NBP2-55657]

Western Blot: GMEB1 Antibody [NBP2-55657]

Western Blot: GMEB1 Antibody [NBP2-55657] - Analysis in human cell lines U-251MG and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: GMEB1 Antibody [NBP2-55657]

Immunocytochemistry/ Immunofluorescence: GMEB1 Antibody [NBP2-55657]

Immunocytochemistry/Immunofluorescence: GMEB1 Antibody [NBP2-55657] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
GMEB1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: GMEB1 Antibody - BSA Free [NBP2-55657]

Chromatin Immunoprecipitation-exo-Seq: GMEB1 Antibody - BSA Free [NBP2-55657]

ChIP-Exo-Seq composite graph for Anti-GMEB1 (NBP2-55657) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for GMEB1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GMEB1

GMEB1 is a member of KDWK gene family. The product of this gene associates with GMEB2 protein, and the complex is essential for parvovirus DNA replication. Study of rat homolog implicates the role of this gene in modulation of transactivation by the glucocorticoid receptor bound to glucocorticoid response elements. Two alternative spliced transcript variants encoding different isoforms exist.

Alternate Names

DNA-binding protein p96PIF, glucocorticoid modulatory element binding protein 1, glucocorticoid modulatory element-binding protein 1, GMEB-1, P96PIF, Parvovirus initiation factor p96, PIF p96, PIF96

Gene Symbol

GMEB1

Additional GMEB1 Products

Product Documents for GMEB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GMEB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GMEB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GMEB1 Antibody - BSA Free and earn rewards!

Have you used GMEB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies