GRF2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35633

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 844-1095 of human GRF2 (NP_941372.1).

Sequence:
ARGVAARPGTLHDFHSHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRLEWQKQTSEGLAEYCTLIDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGNPDYIDGKVNFSKRWQQFNILDSMRCFQQAHYDMRRNDDIINFFNDFSDHLAEEALWELSLKIKPRNITRRKTDREEKT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

121 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GRF2 Antibody - BSA Free

GRF2 Antibody

Immunocytochemistry/ Immunofluorescence: GRF2 Antibody [NBP3-35633] -

Immunocytochemistry/ Immunofluorescence: GRF2 Antibody [NBP3-35633] - Immunofluorescence analysis of L929 cells using GRF2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
GRF2 Antibody

Immunocytochemistry/ Immunofluorescence: GRF2 Antibody [NBP3-35633] -

Immunocytochemistry/ Immunofluorescence: GRF2 Antibody [NBP3-35633] - Immunofluorescence analysis of U-2 OS cells using GRF2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
GRF2 Antibody

Western Blot: GRF2 Antibody [NBP3-35633] -

Western Blot: GRF2 Antibody [NBP3-35633] - Western blot analysis of lysates from Mouse liver, using GRF2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for GRF2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GRF2

GRF2 encodes a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade that may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined. [provided by RefSeq]

Alternate Names

C3GGRF2guanine nucleotide-releasing factor 2 (specific for crk proto-oncogene), CRK SH3-binding GNRP, DKFZp781P1719, Guanine nucleotide-releasing factor 2, Protein C3G, Rap guanine nucleotide exchange factor (GEF) 1, rap guanine nucleotide exchange factor 1

Gene Symbol

RAPGEF1

Additional GRF2 Products

Product Documents for GRF2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GRF2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GRF2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GRF2 Antibody - BSA Free and earn rewards!

Have you used GRF2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...