HIC1 Antibody (4E11) - Azide and BSA Free
Novus Biologicals | Catalog # H00003090-M01
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2b Kappa Clone # 4E11
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
HIC1 (NP_006488, 396 a.a. ~ 453 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YKSSSEETGSSEDPSPPGGHLEGYPCPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLN
Specificity
HIC1 (4E11)
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2b Kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for HIC1 Antibody (4E11) - Azide and BSA Free
Western Blot: HIC1 Antibody (4E11) [H00003090-M01]
Western Blot: HIC1 Antibody (4E11) [H00003090-M01] - HIC1 monoclonal antibody (M01), clone 4E11 Analysis of HIC1 expression in Jurkat.Immunocytochemistry/ Immunofluorescence: HIC1 Antibody (4E11) [H00003090-M01]
Immunocytochemistry/Immunofluorescence: HIC1 Antibody (4E11) [H00003090-M01] - Analysis of monoclonal antibody to HIC1 on HeLa cell. Antibody concentration 10 ug/ml.Western Blot: HIC1 Antibody (4E11) [H00003090-M01]
Western Blot: HIC1 Antibody (4E11) [H00003090-M01] - HIC1 monoclonal antibody (M01), clone 4E11. Analysis of HIC1 expression in PC-12.
Sandwich ELISA: HIC1 Antibody (4E11) [H00003090-M01] - Detection limit for recombinant GST tagged HIC1 is approximately 0.1ng/ml as a capture antibody.
Applications for HIC1 Antibody (4E11) - Azide and BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:10-1:2000
Sandwich ELISA
1:100-1:2000
Western Blot
1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: HIC1
Alternate Names
Hic-1, hypermethylated in cancer 1, ZBTB29hypermethylated in cancer 1 protein, Zinc finger and BTB domain-containing protein 29, ZNF901
Entrez Gene IDs
3090 (Human)
Gene Symbol
HIC1
OMIM
603825 (Human)
UniProt
Additional HIC1 Products
Product Documents for HIC1 Antibody (4E11) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for HIC1 Antibody (4E11) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for HIC1 Antibody (4E11) - Azide and BSA Free
Customer Reviews for HIC1 Antibody (4E11) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review HIC1 Antibody (4E11) - Azide and BSA Free and earn rewards!
Have you used HIC1 Antibody (4E11) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...