HSD17B8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35292

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-261 of human HSD17B8 (NP_055049.1).

Sequence:
MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HSD17B8 Antibody - BSA Free

HSD17B8 Antibody

Western Blot: HSD17B8 Antibody [NBP3-35292] -

Western Blot: HSD17B8 Antibody [NBP3-35292] - Western blot analysis of various lysates using HSD17B8 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
HSD17B8 Antibody

Immunocytochemistry/ Immunofluorescence: HSD17B8 Antibody [NBP3-35292] -

Immunocytochemistry/ Immunofluorescence: HSD17B8 Antibody [NBP3-35292] - Immunofluorescence analysis of U-2 OS cells using HSD17B8 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for HSD17B8 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HSD17B8

In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. [provided by RefSeq]

Alternate Names

D6S2245EdJ1033B10.9, EC 1.1.1.-, EC 1.1.1.62, EC 1.1.1.63,17-beta-HSD 8, estrogen 17-oxidoreductase, FABGLestradiol 17-beta-dehydrogenase 8, H2-KE6, HKE6FabG (beta-ketoacyl-[acyl-carrier-protein] reductase, E coli) like (E. coli), hydroxysteroid (17-beta) dehydrogenase 8,3-oxoacyl-[acyl-carrier-protein] reductase, KE6, ke-6, Ke-6,17-beta-hydroxysteroid dehydrogenase 8, Protein Ke6, Really interesting new gene 2 protein, RING2FABG, SDR30C1, short chain dehydrogenase/reductase family 30C, member 1, Testosterone 17-beta-dehydrogenase 8

Gene Symbol

HSD17B8

Additional HSD17B8 Products

Product Documents for HSD17B8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HSD17B8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HSD17B8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HSD17B8 Antibody - BSA Free and earn rewards!

Have you used HSD17B8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...