Lactate Dehydrogenase C Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35491

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Lactate Dehydrogenase C (NP_002292.1).

Sequence:
ISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Lactate Dehydrogenase C Antibody - BSA Free

Lactate Dehydrogenase C Antibody

Immunocytochemistry/ Immunofluorescence: Lactate Dehydrogenase C Antibody [NBP3-35491] -

Immunocytochemistry/ Immunofluorescence: Lactate Dehydrogenase C Antibody [NBP3-35491] - Immunofluorescence analysis of paraffin-embedded rat testis using Lactate Dehydrogenase C Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Lactate Dehydrogenase C Antibody

Western Blot: Lactate Dehydrogenase C Antibody [NBP3-35491] -

Western Blot: Lactate Dehydrogenase C Antibody [NBP3-35491] - Western blot analysis of various lysates using Lactate Dehydrogenase C Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Lactate Dehydrogenase C Antibody

Immunocytochemistry/ Immunofluorescence: Lactate Dehydrogenase C Antibody [NBP3-35491] -

Immunocytochemistry/ Immunofluorescence: Lactate Dehydrogenase C Antibody [NBP3-35491] - Immunofluorescence analysis of paraffin-embedded mouse testis using Lactate Dehydrogenase C Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Lactate Dehydrogenase C Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Lactate Dehydrogenase C

Lactate dehydrogenase (LDH) is an ubiquitous enzyme commonly found in wide variety of organisms, including plants and microbes. LDH is involved in the interconversion of the pyruvate and NADH to lactate and NAD+. It is also called Hydroxybutyrate Dehydrogenase (HBD), because it can catalyze the oxidation of hydroxybutyrate (1). In mammals, three types of LDH subunits (35 kDa) are encoded by the genes Ldh-A, Ldh-B, and Ldh-C. All LDH subunits can combine to form various terameric isoenzymes (140 kDa) (2). LDHA and LDHB are expressed in most somatic tissues, while expression of LDHC is confined to the germinal epithelium of the testes (3)

Alternate Names

Cancer/testis antigen 32, CT32EC 1.1.1.27, EC 1.1.1, lactate dehydrogenase C, lactate dehydrogenase C4, LDH testis subunit, LDH3MGC111073, LDH-C, LDHX, LDH-X, L-lactate dehydrogenase C chain

Gene Symbol

LDHC

Additional Lactate Dehydrogenase C Products

Product Documents for Lactate Dehydrogenase C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lactate Dehydrogenase C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lactate Dehydrogenase C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lactate Dehydrogenase C Antibody - BSA Free and earn rewards!

Have you used Lactate Dehydrogenase C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...