LARS Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-35479

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all LARS Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human LARS (NP_064502.9).

Sequence:
MAERKGTAKVDFLKKIEKEIQQKWDTERVFEVNASNLEKQTSKGKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKCCLFPFGLHCTGMPIKACADKLKREIELYGCPPDFPDEEEEEEETSVKTEDIIIKDKAKGKKSKAAAKAGSSKYQWGIMKSLGLSDEEIVKFSEAEHWLDYFPPLAIQDLKRMGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLLKLK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

134 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for LARS Antibody - Azide and BSA Free

LARS Antibody

Immunocytochemistry/ Immunofluorescence: LARS Antibody [NBP3-35479] -

Immunocytochemistry/ Immunofluorescence: LARS Antibody [NBP3-35479] - Immunofluorescence analysis of U2OS cells using LARS Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
LARS Antibody

Western Blot: LARS Antibody [NBP3-35479] -

Western Blot: LARS Antibody [NBP3-35479] - Western blot analysis of various lysates using LARS Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
LARS Antibody

Immunocytochemistry/ Immunofluorescence: LARS Antibody [NBP3-35479] -

Immunocytochemistry/ Immunofluorescence: LARS Antibody [NBP3-35479] - Immunofluorescence analysis of L929 cells using LARS Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for LARS Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: LARS

Alternate Names

cytoplasmic leucyl-tRNA synthetase, FLJ21788, hr025Cl, HSPC192, KIAA1352, LARS1, leucine translase, leucine tRNA ligase 1, cytoplasmic, leucine-tRNA ligase, leucine--tRNA ligase, leucyl-tRNA synthetase, leucyl-tRNA synthetase, cytoplasmic, LEURS, LEUS, LRS, PIG44

Gene Symbol

LARS

Additional LARS Products

Product Documents for LARS Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LARS Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LARS Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review LARS Antibody - Azide and BSA Free and earn rewards!

Have you used LARS Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies