LSM14A Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35692

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LSM14A (NP_001107565.1).

Sequence:
MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for LSM14A Antibody - BSA Free

LSM14A Antibody

Immunocytochemistry/ Immunofluorescence: LSM14A Antibody [NBP3-35692] -

Immunocytochemistry/ Immunofluorescence: LSM14A Antibody [NBP3-35692] - Immunofluorescence analysis of L929 cells using LSM14A Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
LSM14A Antibody

Western Blot: LSM14A Antibody [NBP3-35692] -

Western Blot: LSM14A Antibody [NBP3-35692] - Western blot analysis of various lysates using LSM14A Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 90s.

Applications for LSM14A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: LSM14A

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM]

Alternate Names

AlphaSNBP, C19orf13, DKFZp434D1335, FAM61A, family with sequence similarity 61, member A, hRAP55, hRAP55A, LSM14 homolog A, LSM14A, SCD6 homolog A (S. cerevisiae), Protein FAM61A, protein LSM14 homolog A, Protein SCD6 homolog, Putative alpha-synuclein-binding protein, RAP55ALSM14 homolog A (SCD6, S. cerevisiae), RAP55chromosome 19 open reading frame 13, RNA-associated protein 55, RNA-associated protein 55A

Gene Symbol

LSM14A

Additional LSM14A Products

Product Documents for LSM14A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LSM14A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LSM14A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LSM14A Antibody - BSA Free and earn rewards!

Have you used LSM14A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...