Macro H2A.2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92094

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Macro H2A.2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Macro H2A.2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Macro H2A.2 Antibody [NBP1-92094]

Immunohistochemistry-Paraffin: Macro H2A.2 Antibody [NBP1-92094]

Immunohistochemistry-Paraffin: Macro H2A.2 Antibody [NBP1-92094] - Analysis in human endometrium and liver tissues. Corresponding H2AFY2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Macro H2A.2 Antibody [NBP1-92094]

Immunohistochemistry-Paraffin: Macro H2A.2 Antibody [NBP1-92094]

Immunohistochemistry-Paraffin: Macro H2A.2 Antibody [NBP1-92094] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Macro H2A.2 Antibody [NBP1-92094]

Immunohistochemistry-Paraffin: Macro H2A.2 Antibody [NBP1-92094]

Immunohistochemistry-Paraffin: Macro H2A.2 Antibody [NBP1-92094] - Staining of human endometrium shows moderate to strong nuclear positivity in stromal cells.
Macro H2A.2 Antibody - BSA Free Immunohistochemistry: Macro H2A.2 Antibody - BSA Free [NBP1-92094]

Immunohistochemistry: Macro H2A.2 Antibody - BSA Free [NBP1-92094]

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Macro H2A.2 Antibody - BSA Free Immunohistochemistry: Macro H2A.2 Antibody - BSA Free [NBP1-92094]

Immunohistochemistry: Macro H2A.2 Antibody - BSA Free [NBP1-92094]

Staining of human endometrium shows moderate to strong nuclear positivity in stromal cells.
Macro H2A.2 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Macro H2A.2 Antibody - BSA Free [NBP1-92094]

Immunocytochemistry/ Immunofluorescence: Macro H2A.2 Antibody - BSA Free [NBP1-92094]

Staining of human cell line U-2 OS shows localization to nucleoplasm.
Macro H2A.2 Antibody - BSA Free Immunohistochemistry: Macro H2A.2 Antibody - BSA Free [NBP1-92094]

Immunohistochemistry: Macro H2A.2 Antibody - BSA Free [NBP1-92094]

Staining of human cerebellum shows moderate to strong nuclear positivity in both molecular and granular layer.
Macro H2A.2 Antibody - BSA Free Immunohistochemistry: Macro H2A.2 Antibody - BSA Free [NBP1-92094]

Immunohistochemistry: Macro H2A.2 Antibody - BSA Free [NBP1-92094]

Analysis in human endometrium and liver tissues using NBP1-92094 antibody. Corresponding H2AFY2 RNA-seq data are presented for the same tissues.

Applications for Macro H2A.2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Macro H2A.2

Variant histone H2A which replaces conventional H2A in a subset of nucleosomes where it represses transcription. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in stable X chromosome inactivation

Alternate Names

core histone macro-H2A.2, core histone macroH2A2.2, H2A histone family, member Y2, Histone macroH2A2, MACROH2A2, mH2A2

Entrez Gene IDs

55506 (Human)

Gene Symbol

MACROH2A2

UniProt

Q9P0M6 (Human)

Additional Macro H2A.2 Products

Product Documents for Macro H2A.2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Macro H2A.2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Macro H2A.2 Antibody - BSA Free

Customer Reviews for Macro H2A.2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Macro H2A.2 Antibody - BSA Free and earn rewards!

Have you used Macro H2A.2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies