MARK2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35695

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 350-455 of human MARK2 (Q7KZI7).

Sequence:
RYNEVMATYLLLGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAAGPAIPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

88 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MARK2 Antibody - BSA Free

MARK2 Antibody

Immunocytochemistry/ Immunofluorescence: MARK2 Antibody [NBP3-35695] -

Immunocytochemistry/ Immunofluorescence: MARK2 Antibody [NBP3-35695] - Immunofluorescence analysis of L929 cells using MARK2 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
MARK2 Antibody

Western Blot: MARK2 Antibody [NBP3-35695] -

Western Blot: MARK2 Antibody [NBP3-35695] - Western blot analysis of various lysates using MARK2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.

Applications for MARK2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MARK2

EMK (ELKL Motif Kinase) is a small family of ser/thr protein kinases involved in the control of cell polarity, microtubule stability and cancer. Several cDNA clones have been isolated that encoded two isoforms of the human ser/thr protein kinase EMK1. These isoforms were characterized by the presence of a 162-bp alternative exon that gave rise to two forms, one containing the exon and the other one lacking it. Both forms were found to be coexpressed in a number of selected cell lines and tissue samples. The human EMK1 was shown to be encoded by a single mRNA ubiquitously expressed. [provided by RefSeq]

Alternate Names

EC 2.7.11, EC 2.7.11.1, ELKL motif kinase, ELKL motif kinase 1, EMK-1, EMK1PAR-1, MAP/microtubule affinity-regulating kinase 2MGC99619, PAR1 homolog, Par1b, Ser/Thr protein kinase PAR-1B, serine/threonine protein kinase EMK, serine/threonine-protein kinase MARK2

Gene Symbol

MARK2

Additional MARK2 Products

Product Documents for MARK2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MARK2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MARK2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MARK2 Antibody - BSA Free and earn rewards!

Have you used MARK2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...