MRPL43 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93527

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 80-155 of human MRPL43 (NP_789762.1). LNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKPTTFRGLRPREVQDPAPAQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MRPL43 Antibody - Azide and BSA Free

Western Blot: MRPL43 AntibodyAzide and BSA Free [NBP2-93527]

Western Blot: MRPL43 AntibodyAzide and BSA Free [NBP2-93527]

Western Blot: MRPL43 Antibody [NBP2-93527] - Analysis of extracts of various cell lines, using MRPL43 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: MRPL43 Antibody - Azide and BSA Free [NBP2-93527]

Immunocytochemistry/ Immunofluorescence: MRPL43 Antibody - Azide and BSA Free [NBP2-93527]

Immunocytochemistry/Immunofluorescence: MRPL43 Antibody [NBP2-93527] - Analysis of U-2 OS cells using MRPL43 at dilution of 1:100. Blue: DAPI for nuclear staining.
MRPL43 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: MRPL43 Antibody - Azide and BSA Free [NBP2-93527] -

Immunocytochemistry/ Immunofluorescence: MRPL43 Antibody - Azide and BSA Free [NBP2-93527] - Immunofluorescence analysis of L929 cells using MRPL43 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for MRPL43 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MRPL43

MRPL43, also known as Mitochondrial Ribosomal Protein L43, contains several isoforms that are 23 kDa, 22 kDa, 18 kDa, and 17 kDa, and has been associated with protein synthesis in the mitochondria, though its specific function is still unknown. Current research is being conducted on MRPL43 and its connection to several diseases and disorders, including chronic progressive external ophthalmoplegia, prostatitis, Alzheimer's disease, and paraplegia. The protein interacts with ICT1, ARRB2, EIF1B, DDX56, and AARS2.

Alternate Names

39S ribosomal protein L43, mitochondrial, bMRP36a, L43mt, MGC17989, MGC48892, Mitochondrial ribosomal protein bMRP36a, mitochondrial ribosomal protein L43, MRP-L43

Gene Symbol

MRPL43

Additional MRPL43 Products

Product Documents for MRPL43 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPL43 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for MRPL43 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MRPL43 Antibody - Azide and BSA Free and earn rewards!

Have you used MRPL43 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...