NMES1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98391

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Western Blot, Flow Cytometry

Cited:

Western Blot, Flow Cytometry

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NMES1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is C15orf48 - N-terminal region. Peptide sequence VAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NMES1 Antibody - BSA Free

Western Blot: NMES1 Antibody [NBP1-98391]

Western Blot: NMES1 Antibody [NBP1-98391]

Western Blot: NMES1 Antibody [NBP1-98391] - Host: Rabbit. Target Name: C15orf48. Sample Tissue: Human PANC1 Whole Cell. Antibody at 1 ug/mL.
Flow Cytometry: NMES1 Antibody [NBP1-98391]

Flow Cytometry: NMES1 Antibody [NBP1-98391]

Flow Cytometry: NMES1 Antibody [NBP1-98391] - Anti-NMES1 antibody at 1:500 dilution. Cells were labeled with a FITC-conjugated secondary antibody. Top: unstained; grey; and NMES1-labeled; blue; cells. Bottom: NMES1 fluorescence with no primary antibody added; dotted line; and labeled; solid line; cells. Flow cytometry image submitted by a verified customer review.
Western Blot: NMES1 Antibody [NBP1-98391]

Western Blot: NMES1 Antibody [NBP1-98391]

Western Blot: NMES1 Antibody [NBP1-98391] - PANC1 Cell Lysate. Antiboyd at 1.0 ug/mL, Gel Concentration: 10-20%.
NMES1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NMES1 Antibody - BSA Free [NBP1-98391] -

C15ORF48 expression activates AMPK-ULK1 signaling.a A549 cells stably expressing C15ORF48 (A549/C15ORF48) or the empty (A549/empty) vector were fixed and stained with anti-C15ORF48 antibody and MitoTracker. Nuclei were counter-stained with TO-PRO-3. Representative images are shown from three independent experiments. b A549/empty and A549/C15ORF48 cells were analyzed for mitochondrial membrane potential by staining with TMRM (30 nM) for 30 min. Median TMRM fluorescence intensities are shown as the mean +/- SD. Statistical significance was calculated using two-tailed unpaired Student’s t test (n = 3, biological replicates). c A549/empty and A549/C15ORF48 cells were analyzed for intracellular ATP levels. ATP amount in a cell is shown as the mean +/- SD. Statistical significance was calculated using two-tailed unpaired Student’s t test (n = 3, biological replicates). d A549/empty and A549/C15ORF48 cells were lysed and subjected to western blotting with indicated antibodies. Band intensity was measured, and quantitative ratios are shown. Data are representative of three independent experiments with three biological replicates. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41467-024-45206-1), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for NMES1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
This NMES1 antibody is validated for Flow cytometry from a verified customer review.

Reviewed Applications

Read 1 review rated 5 using NBP1-98391 in the following applications:

Flow Cytometry Panel Builder

Bio-Techne Knows Flow Cytometry

Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.

Advanced Features

  • Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
  • Spillover Popups - Visualize the spectra of individual fluorochromes
  • Antigen Density Selector - Match fluorochrome brightness with antigen density
Build Your Panel Now
Flow Cytometry

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NMES1

This gene was identified by its low or completely missing expression in esophageal squamous cell carcinomas. Normal expression of the gene occurs in the esophagus, stomach, small intestine, colon and placenta. Alternatively spliced transcript variants that encode the same protein have been identified.

Alternate Names

C15orf48, chromosome 15 open reading frame 48, FLJ22645, FOAP-11, MGC32925, NMES1, NMES1normal mucosa of esophagus specific 1, normal mucosa of esophagus-specific gene 1 protein, Protein FOAP-11

Gene Symbol

C15ORF48

UniProt

NP_115789 (Human)

Additional NMES1 Products

Product Documents for NMES1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NMES1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NMES1 Antibody - BSA Free

Customer Reviews for NMES1 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used NMES1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 的 1 review Showing All
Filter By:
Clear Filters X
  • NMES1 Antibody
    Name: David Donley
    Application: Flow Cytometry
    Sample Tested: Cell culture
    Species: Mouse
    Verified Customer | Posted 07/17/2020
    Anti-NMES1 at 1:500 dilution. Cells were labeled with a FITC-conjugated secondary antibody. Top: unstained; grey; and NMES1-labeled; blue; cells. Bottom: NMES1 fluorescence with no primary antibody added; dotted line; and labeled; solid line; cells.
    NMES1 Antibody - BSA Free NBP1-98391

There are no reviews that match your criteria.

Showing  1 - 1 的 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies