P2X5/P2RX5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35187

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 341-422 of human P2X5/P2RX5 (NP_002552.2).

Sequence:
KKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for P2X5/P2RX5 Antibody - BSA Free

P2X5/P2RX5 Antibody

Immunocytochemistry/ Immunofluorescence: P2X5/P2RX5 Antibody [NBP3-35187] -

Immunocytochemistry/ Immunofluorescence: P2X5/P2RX5 Antibody [NBP3-35187] - Immunofluorescence analysis of Jurkat cells using P2X5/P2RX5 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
P2X5/P2RX5 Antibody

Immunocytochemistry/ Immunofluorescence: P2X5/P2RX5 Antibody [NBP3-35187] -

Immunocytochemistry/ Immunofluorescence: P2X5/P2RX5 Antibody [NBP3-35187] - Immunofluorescence analysis of paraffin-embedded mouse spleen using P2X5/P2RX5 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
P2X5/P2RX5 Antibody

Western Blot: P2X5/P2RX5 Antibody [NBP3-35187] -

Western Blot: P2X5/P2RX5 Antibody [NBP3-35187] - Western blot analysis of various lysates using P2X5/P2RX5 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for P2X5/P2RX5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: P2X5/P2RX5

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the purinoceptors family, this receptor has only a single transmembrane domain. Three transcript variants encoding distinct isoforms have been identified for this gene.

Long Name

P2X Purinergic Receptor 5

Alternate Names

LRH-1, P2RX5

Gene Symbol

P2RX5

Additional P2X5/P2RX5 Products

Product Documents for P2X5/P2RX5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for P2X5/P2RX5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for P2X5/P2RX5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review P2X5/P2RX5 Antibody - BSA Free and earn rewards!

Have you used P2X5/P2RX5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...