PBX2 Antibody (2E9) - Azide and BSA Free

Novus Biologicals | Catalog # H00005089-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2E9

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

PBX2 (NP_002577, 354 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN

Specificity

PBX2 - pre-B-cell leukemia transcription factor 2

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for PBX2 Antibody (2E9) - Azide and BSA Free

Western Blot: PBX2 Antibody (2E9) [H00005089-M01]

Western Blot: PBX2 Antibody (2E9) [H00005089-M01]

Western Blot: PBX2 Antibody (2E9) [H00005089-M01] - Analysis of PBX2 expression in transfected 293T cell line by PBX2 monoclonal antibody (M01), clone 2E9.Lane 1: PBX2 transfected lysate(45.9 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: PBX2 Antibody (2E9) [H00005089-M01]

Immunocytochemistry/ Immunofluorescence: PBX2 Antibody (2E9) [H00005089-M01]

Immunocytochemistry/Immunofluorescence: PBX2 Antibody (2E9) [H00005089-M01] - Analysis of monoclonal antibody to PBX2 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: PBX2 Antibody (2E9) [H00005089-M01]

Western Blot: PBX2 Antibody (2E9) [H00005089-M01]

Western Blot: PBX2 Antibody (2E9) [H00005089-M01] - Analysis of PBX2 over-expressed 293 cell line, cotransfected with PBX2 Validated Chimera RNAi ( Cat # H00005089-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PBX2 monoclonal antibody (M01), clone 2E9 (Cat # H00005089-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: PBX2 Antibody (2E9) [H00005089-M01]

Western Blot: PBX2 Antibody (2E9) [H00005089-M01]

Western Blot: PBX2 Antibody (2E9) [H00005089-M01] - PBX2 monoclonal antibody (M01), clone 2E9 Analysis of PBX2 expression in Hela S3 NE.

Applications for PBX2 Antibody (2E9) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: PBX2

This gene encodes a ubiquitously expressed member of the TALE/PBX homeobox family. It was identified by its similarity to a homeobox gene which is involved in t(1;19) translocation in acute pre-B-cell leukemias. This protein is a transcriptional activator which binds to the TLX1 promoter. The gene is located within the major histocompatibility complex (MHC) on chromosome 6.

Alternate Names

G17Homeobox protein PBX2, HOX12homeobox 12, PBX2MHC, pre-B-cell leukemia homeobox 2, pre-B-cell leukemia transcription factor 2, Protein G17

Entrez Gene IDs

5089 (Human)

Gene Symbol

PBX2

OMIM

176311 (Human)

Additional PBX2 Products

Product Documents for PBX2 Antibody (2E9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PBX2 Antibody (2E9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PBX2 Antibody (2E9) - Azide and BSA Free

Customer Reviews for PBX2 Antibody (2E9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PBX2 Antibody (2E9) - Azide and BSA Free and earn rewards!

Have you used PBX2 Antibody (2E9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...