PBX2 Antibody (2E9) - Azide and BSA Free
Novus Biologicals | Catalog # H00005089-M01
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2a Kappa Clone # 2E9
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
PBX2 (NP_002577, 354 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN
Specificity
PBX2 - pre-B-cell leukemia transcription factor 2
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2a Kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for PBX2 Antibody (2E9) - Azide and BSA Free
Western Blot: PBX2 Antibody (2E9) [H00005089-M01]
Western Blot: PBX2 Antibody (2E9) [H00005089-M01] - Analysis of PBX2 expression in transfected 293T cell line by PBX2 monoclonal antibody (M01), clone 2E9.Lane 1: PBX2 transfected lysate(45.9 KDa).Lane 2: Non-transfected lysate.Immunocytochemistry/ Immunofluorescence: PBX2 Antibody (2E9) [H00005089-M01]
Immunocytochemistry/Immunofluorescence: PBX2 Antibody (2E9) [H00005089-M01] - Analysis of monoclonal antibody to PBX2 on HeLa cell. Antibody concentration 10 ug/ml.Western Blot: PBX2 Antibody (2E9) [H00005089-M01]
Western Blot: PBX2 Antibody (2E9) [H00005089-M01] - Analysis of PBX2 over-expressed 293 cell line, cotransfected with PBX2 Validated Chimera RNAi ( Cat # H00005089-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PBX2 monoclonal antibody (M01), clone 2E9 (Cat # H00005089-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Western Blot: PBX2 Antibody (2E9) [H00005089-M01]
Western Blot: PBX2 Antibody (2E9) [H00005089-M01] - PBX2 monoclonal antibody (M01), clone 2E9 Analysis of PBX2 expression in Hela S3 NE.Applications for PBX2 Antibody (2E9) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: PBX2
Alternate Names
G17Homeobox protein PBX2, HOX12homeobox 12, PBX2MHC, pre-B-cell leukemia homeobox 2, pre-B-cell leukemia transcription factor 2, Protein G17
Entrez Gene IDs
5089 (Human)
Gene Symbol
PBX2
OMIM
176311 (Human)
UniProt
Additional PBX2 Products
Product Documents for PBX2 Antibody (2E9) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PBX2 Antibody (2E9) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for PBX2 Antibody (2E9) - Azide and BSA Free
Customer Reviews for PBX2 Antibody (2E9) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review PBX2 Antibody (2E9) - Azide and BSA Free and earn rewards!
Have you used PBX2 Antibody (2E9) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...