PDLIM7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58734

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (98%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GKTPVCHQCHKVIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITGEIMHALKMTWH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PDLIM7 Antibody - BSA Free

Western Blot: PDLIM7 Antibody [NBP2-58734]

Western Blot: PDLIM7 Antibody [NBP2-58734]

Western Blot: PDLIM7 Antibody [NBP2-58734] - Analysis using Anti-PDLIM7 antibody NBP2-58734 (A) shows similar pattern to independent antibody NBP1-84841 (B).
Immunocytochemistry/ Immunofluorescence: PDLIM7 Antibody [NBP2-58734]

Immunocytochemistry/ Immunofluorescence: PDLIM7 Antibody [NBP2-58734]

Immunocytochemistry/Immunofluorescence: PDLIM7 Antibody [NBP2-58734] - Staining of human cell line U-251 MG shows localization to nucleus, actin filaments & focal adhesion sites.

Applications for PDLIM7 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PDLIM7

PDLIM7 is encoded by this gene is representative of a family of proteins composed of conserved PDZ and LIM domains. LIM domains are proposed to function in protein-protein recognition in a variety of contexts including gene transcription and development and in cytoskeletal interaction. The LIM domains of this protein bind to protein kinases, whereas the PDZ domain binds to actin filaments. The gene product is involved in the assembly of an actin filament-associated complex essential for transmission of ret/ptc2 mitogenic signaling. The biological function is likely to be that of an adapter, with the PDZ domain localizing the LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Alternative splicing of this gene results in multiple transcript variants.

Alternate Names

1110003B01Rik, ENIGMAProtein enigma, LIM domain protein, LIM mineralization protein, LMP, LMP1, PDZ and LIM domain 7 (enigma), PDZ and LIM domain protein 7

Gene Symbol

PDLIM7

Additional PDLIM7 Products

Product Documents for PDLIM7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PDLIM7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PDLIM7 Antibody - BSA Free

Customer Reviews for PDLIM7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PDLIM7 Antibody - BSA Free and earn rewards!

Have you used PDLIM7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...