Pericentrin Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35916

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Pericentrin Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 95-212 of human Pericentrin (NP_006022.3).

Sequence:
GEKREDLEQLQQKQVNDHPPEQCGMFTVSDHPPEQHGMFTVGDHPPEQRGMFTVSDHPPEQHGMFTVSDHPPEQRGMFTISDHQPEQRGMFTVSDHTPEQRGIFTISDHPAEQRGMFT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

378 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Pericentrin Antibody - BSA Free

Pericentrin Antibody

Western Blot: Pericentrin Antibody [NBP3-35916] -

Western Blot: Pericentrin Antibody [NBP3-35916] - Western blot analysis of various lysates using Pericentrin Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
Pericentrin Antibody

Immunocytochemistry/ Immunofluorescence: Pericentrin Antibody [NBP3-35916] -

Immunocytochemistry/ Immunofluorescence: Pericentrin Antibody [NBP3-35916] - Immunofluorescence analysis of U-2 OS cells using Pericentrin Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Pericentrin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Pericentrin

Pericentrin is encoded by this gene binds to calmodulin and is expressed in the centrosome. It is an integral component of the pericentriolar material (PCM). The protein contains a series of coiled-coil domains and a highly conserved PCM targeting motif called the PACT domain near its C-terminus. The protein interacts with the microtubule nucleation component gamma-tubulin and is likely important to normal functioning of the centrosomes, cytoskeleton, and cell-cycle progression.

Alternate Names

Kendrin, KIAA0402, MOPD2, PCN, PCNT2pericentrin B, PCNTB, pericentrin, pericentrin 2 (kendrin), pericentrin, kendrin (KIAA0402)10KENPCTN2, pericentrin-2, pericentrin-380, Pericentrin-B, SCKL4kendrin

Gene Symbol

PCNT

Additional Pericentrin Products

Product Documents for Pericentrin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Pericentrin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Pericentrin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Pericentrin Antibody - BSA Free and earn rewards!

Have you used Pericentrin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies