PHKG2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55815

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PHKG2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PHKG2 Antibody - BSA Free

Western Blot: PHKG2 Antibody [NBP2-55815]

Western Blot: PHKG2 Antibody [NBP2-55815]

Western Blot: PHKG2 Antibody [NBP2-55815] - Analysis using Anti-PHKG2 antibody NBP2-55815 (A) shows similar pattern to independent antibody NBP2-56609 (B).
Immunocytochemistry/ Immunofluorescence: PHKG2 Antibody [NBP2-55815]

Immunocytochemistry/ Immunofluorescence: PHKG2 Antibody [NBP2-55815]

Immunocytochemistry/Immunofluorescence: PHKG2 Antibody [NBP2-55815] - Staining of human cell line MCF7 shows localization to cytosol.

Applications for PHKG2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PHKG2

PHKG2, also known as Phosphorylase b kinase gamma catalytic chain, liver/testis isoform, has 2 isoforms, a 406 amino acid long isoform that is 46 kDa and a short 374 amino acid isoform that is 43 kDa, as catalytic subunit of the phosphorylase b kinase (PHK) mediates the neural and hormonal regulation of glycogen breakdown (glycogenolysis) by phosphorylating and thereby activating glycogen phosphorylase and may regulate glycogeneolysis in the testis and phosphorylates PYGM in vitro. Studies on this protein have shown a relationship with the following diseases and disorders: glycogen storage disease, cirrhosis due to liver, phosphorylase kinase deficiency, hepatitis, metabolic disorders, hypotonia malaria, and alcoholism. This protein has interactions with PHKG1, UBE3A, PHKA2, PHKB, and PYGL in PKA signaling, cAMP Pathway, activation of cAMP-dependent PKA, alpha-adrenergic signaling, metabolism of carbohydrates, glycogen breakdown (glycogenolysis), glucose metabolism, calcium signaling pathway and insulin signaling pathway.

Alternate Names

EC 2.7.11, EC 2.7.11.19, GSD9C, PHK-gamma-T, phosphorylase b kinase gamma catalytic chain, testis/liver isoform, Phosphorylase kinase subunit gamma-2, phosphorylase kinase, gamma 2 (testis), Phosphorylase kinase, gamma 2 (testis/liver), PSK-C3

Gene Symbol

PHKG2

Additional PHKG2 Products

Product Documents for PHKG2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PHKG2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PHKG2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PHKG2 Antibody - BSA Free and earn rewards!

Have you used PHKG2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies