Recombinant Human PI 3-Kinase p85 alpha GST (N-Term) Protein
Novus Biologicals | Catalog # H00005295-Q01
Key Product Details
Source
Tag
Applications
Product Specifications
Description
Source: Wheat Germ (in vitro)
Amino Acid Sequence: IQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSN
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
Protein / Peptide Type
Scientific Data Images for Recombinant Human PI 3-Kinase p85 alpha GST (N-Term) Protein
Formulation, Preparation, and Storage
H00005295-Q01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: PI 3-Kinase p85 alpha
The PI3K pathway functions in a broad range of cellular processes, so it is understandable that pathway dysfunction can lead to an array of diseases and disorders (2,5). Elevated PI3K signaling is a key feature of many cancers (5). PI3K pathway dysregulation has also been implicated in neurological, metabolic, and cardiovascular disorders (5). Furthermore, both overactivation or under-activation of the PI3K delta (p85 alpha subunit + p110 delta subunit) pathway has been shown to cause immunodeficiency and pathologies related to immune system dysfunction (2). Therapeutics to target the PI3K pathway and treat related cancers include PI3K inhibitors and, specifically, isoform-selective inhibitors which have a lot of promise when used as part of a combination therapy (5).
References
1. Okkenhaug, K., & Vanhaesebroeck, B. (2001). New responsibilities for the PI3K regulatory subunit p85 alpha. Science's STKE : signal transduction knowledge environment. https://doi.org/10.1126/stke.2001.65.pe1
2. Nunes-Santos, C. J., Uzel, G., & Rosenzweig, S. D. (2019). PI3K pathway defects leading to immunodeficiency and immune dysregulation. The Journal of allergy and clinical immunology. https://doi.org/10.1016/j.jaci.2019.03.017
3. Chen, P. H., Yao, H., & Huang, L. J. (2017). Cytokine Receptor Endocytosis: New Kinase Activity-Dependent and -Independent Roles of PI3K. Frontiers in endocrinology. https://doi.org/10.3389/fendo.2017.00078
4. Uniprot (P27986)
5. Fruman, D. A., Chiu, H., Hopkins, B. D., Bagrodia, S., Cantley, L. C., & Abraham, R. T. (2017). The PI3K Pathway in Human Disease. Cell. https://doi.org/10.1016/j.cell.2017.07.029
Long Name
Alternate Names
Gene Symbol
Additional PI 3-Kinase p85 alpha Products
Product Documents for Recombinant Human PI 3-Kinase p85 alpha GST (N-Term) Protein
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Recombinant Human PI 3-Kinase p85 alpha GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Customer Reviews for Recombinant Human PI 3-Kinase p85 alpha GST (N-Term) Protein
There are currently no reviews for this product. Be the first to review Recombinant Human PI 3-Kinase p85 alpha GST (N-Term) Protein and earn rewards!
Have you used Recombinant Human PI 3-Kinase p85 alpha GST (N-Term) Protein?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars