RAR beta/NR1B2 Antibody (6D5V4)

Novus Biologicals | Catalog # NBP3-16428

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6D5V4 expressed in HEK293
View all RAR beta/NR1B2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 350-455 of human RAR beta/NR1B2 (NP_000956.2). KLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit RAR beta/NR1B2 Antibody (6D5V4) (NBP3-16428) is a recombinant monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for RAR beta/NR1B2 Antibody (6D5V4)

Western Blot: RAR beta/NR1B2 Antibody (6D5V4) [NBP3-16428]

Western Blot: RAR beta/NR1B2 Antibody (6D5V4) [NBP3-16428]

Western Blot: RAR beta/NR1B2 Antibody (6D5V4) [NBP3-16428] - Western blot analysis of extracts of various cell lines, using RAR beta/NR1B2 Rabbit mAb (NBP3-16428) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: RAR beta/NR1B2 Antibody (6D5V4) [NBP3-16428]

Immunocytochemistry/ Immunofluorescence: RAR beta/NR1B2 Antibody (6D5V4) [NBP3-16428]

Immunocytochemistry/Immunofluorescence: RAR beta/NR1B2 Antibody (6D5V4) [NBP3-16428] - Immunofluorescence analysis of NIH-3T3 cells using RAR beta/NR1B2 Rabbit mAb (NBP3-16428) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: RAR beta/NR1B2 Antibody (6D5V4) [NBP3-16428]

Immunocytochemistry/ Immunofluorescence: RAR beta/NR1B2 Antibody (6D5V4) [NBP3-16428]

Immunocytochemistry/Immunofluorescence: RAR beta/NR1B2 Antibody (6D5V4) [NBP3-16428] - Immunofluorescence analysis of HeLa using RAR beta/NR1B2 Rabbit mAb (NBP3-16428) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for RAR beta/NR1B2 Antibody (6D5V4)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:1000 - 1:4000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RAR beta/NR1B2

Retinoids can reverse various premalignant lesions as well as prevent some second primary tumors. The effects of retinoids are regulated by retinoic acid receptors (RAR) and retinoid X receptors, which act as ligand-activated transcription factors. Ligand-dependent transcriptional activation of RARs is a multistep process that ends with the formation of a multimeric co-activator complex on regulated promoters (1,2). Loss of RAR-beta expression and the accumulation of p53 and Ki67 proteins may help in the early identification of esophageal cancer in high-risk populations (3).

Long Name

Retinoic Acid Receptor, beta

Alternate Names

HAP, NR1B2, RARB, RRB2

Gene Symbol

RARB

Additional RAR beta/NR1B2 Products

Product Documents for RAR beta/NR1B2 Antibody (6D5V4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RAR beta/NR1B2 Antibody (6D5V4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAR beta/NR1B2 Antibody (6D5V4)

There are currently no reviews for this product. Be the first to review RAR beta/NR1B2 Antibody (6D5V4) and earn rewards!

Have you used RAR beta/NR1B2 Antibody (6D5V4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RAR beta/NR1B2 Antibody (6D5V4)

Showing  1 - 1 的 1 FAQ Showing All

    • Q: I am planning to perform IHC staining of RARB on FFPE samples. I have found the reference "J Cutan Pathol 2009;36; 1141-1145" used an antibody from your company. Would you let me know any other references using the antibody for IHC staining of RARB?
      A: Unfortunately we are not aware of any other publication wherein our Retinoic Acid Receptor beta antibodies were cited for their use in IHC application. From our sales records, it looks like the researcher used catalog number NB200-323 in the publication you mentioned. Retinoic Acid Receptor beta antibody NB200-323 is our best selling product among this category and it has also been cited for its use in WB application by Yang et al. in Am J Physiol Renal Physiol. 2008 Jun;294(6):F1433-40. We have at least 7 primary antibody products to Retinoic Acid Receptor beta that have been validated for IHC-P application.. We stand behind the quality of our products and offer 100% guarantee for the applications/species mentioned on the datasheets. We are always there to help if you come up with any difficulties and yes, we provide replacements/refunds after troubleshooting a problem, if you do not get your desired outcome! Therefore, please let us know if you have any specific questions or concerns on the IHC-P application of our Retinoic Acid Receptor beta antibodies. You may contact us at technical@novusbio.com.
Showing  1 - 1 的 1 FAQ Showing All
View all FAQs for Antibodies