RBM14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35319

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 110-220 of human RBM14 (NP_006319.1).

Sequence:
VVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

69 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RBM14 Antibody - BSA Free

RBM14 Antibody

Immunocytochemistry/ Immunofluorescence: RBM14 Antibody [NBP3-35319] -

Immunocytochemistry/ Immunofluorescence: RBM14 Antibody [NBP3-35319] - Immunofluorescence analysis of U2OS cells using RBM14 Rabbit pAb at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
RBM14 Antibody

Immunocytochemistry/ Immunofluorescence: RBM14 Antibody [NBP3-35319] -

Immunocytochemistry/ Immunofluorescence: RBM14 Antibody [NBP3-35319] - Immunofluorescence analysis of NIH/3T3 cells using RBM14 Rabbit pAb at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
RBM14 Antibody

Western Blot: RBM14 Antibody [NBP3-35319] -

Western Blot: RBM14 Antibody [NBP3-35319] - Western blot analysis of various lysates using RBM14 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.

Applications for RBM14 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:100 - 1:500

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RBM14

CoAA is a RNA-binding protein. These proteins contribute to gene expression by regulating the form, abundance and stability of both coding and non-coding RNAs. In vertebrates, RNA binding proteins can also influence many processes involved in RNA processing, for example, activity-dependent transcript localization and localized protein synthesis amongst others.

Alternate Names

COAAMGC31756, Paraspeckle protein 2, PSP2DKFZp779J0927, RNA binding motif protein 14, RNA-binding motif protein 14, RNA-binding protein 14, RRM-containing coactivator activator/modulator, SIPMGC15912, Synaptotagmin-interacting protein, SYT-interacting protein, SYTIP1, TMEM137, transmembrane protein 137

Gene Symbol

RBM14

Additional RBM14 Products

Product Documents for RBM14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RBM14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RBM14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RBM14 Antibody - BSA Free and earn rewards!

Have you used RBM14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...