Recombinant Human CD44v6 Fc Chimera Protein, CF
R&D Systems | Catalog # 11175-CD
Loading...
Key Product Details
- R&D Systems CHO-derived Recombinant Human CD44v6 Fc Chimera Protein (11175-CD)
- Quality control testing to verify active proteins with lot specific assays by in-house scientists
- All R&D Systems proteins are covered with a 100% guarantee
Source
CHO
Accession Number
Structure / Form
Disulfide-linked homodimer
Applications
Bioactivity
Loading...
Product Specifications
Source
Chinese Hamster Ovary cell line, CHO-derived human CD44 protein
| Human CD44v6 (Gln21-Thr222) (IQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAG)(Asp224-Trp269) Accession # NP_001001391.1 |
GGIEGRMD | Human IgG1 (Pro100-Lys330) |
| N-terminus | C-terminus |
Purity
>95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
Endotoxin Level
<0.10 EU per 1 μg of the protein by the LAL method.
N-terminal Sequence Analysis
Gln21
Predicted Molecular Mass
59 kDa
SDS-PAGE
105-120 kDa, under reducing conditions.
Activity
Measured by its binding ability in a functional ELISA.
When Recombinant Human CD44v6 Fc Chimera (Catalog # 11175-CD) is immobilized at 1 µg/mL (100 µL/well), Biotinylated Hyaluronan binds with an ED50 of 4.00-40.0 ng/mL.
When Recombinant Human CD44v6 Fc Chimera (Catalog # 11175-CD) is immobilized at 1 µg/mL (100 µL/well), Biotinylated Hyaluronan binds with an ED50 of 4.00-40.0 ng/mL.
Scientific Data Images for Recombinant Human CD44v6 Fc Chimera Protein, CF
Recombinant Human CD44v6 Fc Chimera Protein Binding Activity.
When Recombinant Human CD44v6 Fc Chimera Protein (Catalog # 11175-CD) is immobilized at 1 µg/mL (100 µL/well), Biotinylated Hyaluronan binds with an ED50 of 4.00-40.0 ng/mL.Recombinant Human CD44v6 Fc Chimera Protein SDS-PAGE.
2 μg/lane of Recombinant Human CD44v6 Fc Chimera Protein (Catalog # 11175-CD) was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by Coomassie® Blue staining, showing bands at 105-120 kDa and 210-240 kDa, respectively.Formulation, Preparation, and Storage
11175-CD
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. |
| Reconstitution | Reconstitute at 500 μg/mL in PBS. |
| Shipping | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
|
Calculators
Background: CD44
References
- Ponta, H. et al. (2003) Nat. Rev. Mol. Cell Biol. 4:33.
- Screaton, G.R. et al. (1992) Proc. Natl. Acad. Sci. USA 89:12160.
- Screaton, G.R. et al. (1993) J. Biol. Chem. 268:12235.
- Lynch, K.W. (2004) Nat. Rev. Immunol. 4:931.
- Todaro, M. et al. (2014) Cell stem cell 14:342.
- Vizoso, F.J. et al. (2004) J. Cancer Res. Clin. Oncol. 130:679.
- Ma, L. et al. (2019) Cell Death Dis. 10:30.
- Yu, Q. and B.P. Toole (1996) J. Biol. Chem. 271:20603.
- Nagano, O. and H. Saya (2004) Cancer Sci. 95:930.
- Nakamura, H. et al. (2004) Cancer Res. 64:876.
- Murakami, D. et al. (2003) Oncogene 22:1511.
- Lammich, S. et al. (2002) J. Biol. Chem. 277:44754.
Alternate Names
CD44, ECMR-III, HCAM, HCELL, LHR, MDU2, MDU3, MIC4, MUTCH-I, Pgp1
Gene Symbol
CD44
UniProt
Additional CD44 Products
Product Documents for Recombinant Human CD44v6 Fc Chimera Protein, CF
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Note: Certificate of Analysis not available for kit components.
Product Specific Notices for Recombinant Human CD44v6 Fc Chimera Protein, CF
For research use only
Related Research Areas
Customer Reviews for Recombinant Human CD44v6 Fc Chimera Protein, CF
There are currently no reviews for this product. Be the first to review Recombinant Human CD44v6 Fc Chimera Protein, CF and earn rewards!
Have you used Recombinant Human CD44v6 Fc Chimera Protein, CF?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Loading...