SLC22A12 Antibody (2B5) - Azide and BSA Free

Novus Biologicals | Catalog # H00116085-M02

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2B5

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SLC22A12 (NP_653186.2, 281 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR

Specificity

SLC22A12 - solute carrier family 22 (organic anion/cation transporter), member 12 (2B5)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for SLC22A12 Antibody (2B5) - Azide and BSA Free

Western Blot: SLC22A12 Antibody (2B5) [H00116085-M02]

Western Blot: SLC22A12 Antibody (2B5) [H00116085-M02]

Western Blot: SLC22A12 Antibody (2B5) [H00116085-M02] - SLC22A12 monoclonal antibody (M02), clone 2B5. Analysis of SLC22A12 expression in human stomach.
ELISA: SLC22A12 Antibody (2B5) [H00116085-M02]

ELISA: SLC22A12 Antibody (2B5) [H00116085-M02]

ELISA: SLC22A12 Antibody (2B5) [H00116085-M02] - Detection limit for recombinant GST tagged SLC22A12 is 0.3 ng/ml as a capture antibody.

Applications for SLC22A12 Antibody (2B5) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SLC22A12

The protein encoded by this gene is a urate transporter and urate-anion exchanger which regulates the level of urate in the blood. This protein is an integral membrane protein primarily found in kidney. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Long Name

Solute carrier family 22 member 12

Alternate Names

OATL4, RST, UNQ6453/PRO34004, URAT1

Entrez Gene IDs

116085 (Human)

Gene Symbol

SLC22A12

Additional SLC22A12 Products

Product Documents for SLC22A12 Antibody (2B5) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC22A12 Antibody (2B5) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SLC22A12 Antibody (2B5) - Azide and BSA Free

Customer Reviews for SLC22A12 Antibody (2B5) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SLC22A12 Antibody (2B5) - Azide and BSA Free and earn rewards!

Have you used SLC22A12 Antibody (2B5) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...