Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot, ELISA, Immunoprecipitation
Label
Unconjugated
Antibody Source
Monoclonal Rabbit IgG Clone # 1X5G9
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Smad5 (Q99717).
Sequence:
STYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
Sequence:
STYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Smad5 Antibody (1X5G9)
Immunoprecipitation: Smad5 Antibody (1X5G9) [NBP3-33193] -
Immunoprecipitation: Smad5 Antibody (1X5G9) [NBP3-33193] - Immunoprecipitation analysis of 300 ug extracts of K-562 cells using 3 ug Smad5 antibody. Western blot was performed from the immunoprecipitate using Smad5 antibody at a dilution of 1:1000.Western Blot: Smad5 Antibody (1X5G9) [NBP3-33193] -
Western Blot: Smad5 Antibody (1X5G9) [NBP3-33193] - Western blot analysis of lysates from K-562 cells, using Smad5 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
Western Blot: Smad5 Antibody (1X5G9) [NBP3-33193] -
Western Blot: Smad5 Antibody (1X5G9) [NBP3-33193] - Western blot analysis of lysates from C2C12 cells, using Smad5 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Applications for Smad5 Antibody (1X5G9)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 ug/mL
Immunoprecipitation
0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
Western Blot
1:1000 - 1:4000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Smad5
Long Name
Mothers Against DPP Homolog 5
Alternate Names
Dwfc, JV5-1, MADH5
Gene Symbol
SMAD5
Additional Smad5 Products
Product Documents for Smad5 Antibody (1X5G9)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Smad5 Antibody (1X5G9)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Smad5 Antibody (1X5G9)
There are currently no reviews for this product. Be the first to review Smad5 Antibody (1X5G9) and earn rewards!
Have you used Smad5 Antibody (1X5G9)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Immunoprecipitation Protocol
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...