SNX1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-56957
Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NNGSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYE
Reactivity Notes
Mouse 84%, Rat 84%
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SNX1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: SNX1 Antibody [NBP2-56957]
Immunocytochemistry/Immunofluorescence: SNX1 Antibody [NBP2-56957] - Staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.Immunocytochemistry/ Immunofluorescence: SNX1 Antibody - BSA Free [NBP2-56957] -
A pool of SNX1-positive membranes at vicinity of nascent autophagosomes.(A) Time-lapse images of HeLa cells expressing SNX1-GFP and DCFP1-RFP under starved conditions (stv., 15 min). Arrowheads indicate SNX1-GFP–positive tubules associated with DFPC1-RFP structures. Scale bars = 1 um. (B) HeLa cells expressing Sec61 beta -RFP (magenta) and DFCP1-GFP (yellow) were grown under starvation for 1 h, fixed and stained with anti-SNX1 (blue) antibodies and observed by confocal microscopy. Scale bar = 5 um. (B, C) Magnified area (×4.5) from confocal image (B), top panel, showing codistribution event between Sec61 beta -RFP (magenta), SNX1 (blue), and DFCP1-GFP (yellow) and 3D rendering view of magnified area, bottom panel, showing the surface of Sec61 beta -RFP (magenta), SNX1 (blue), and DFCP1-GFP (yellow). Scale bars = 1 um. (C, D) Quantification of SNX1 codistribution with DFCP1-GFP and Sec61 beta -RFP (ER)-positive domains per 100 um2 as illustrated in (C). Means +/- SEM, from three independent experiments; ***P < 0.001 in unpaired two-tailed t test. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36585258), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: SNX1 Antibody - BSA Free [NBP2-56957] -
A pool of SNX1-positive membranes at vicinity of nascent autophagosomes.(A) Time-lapse images of HeLa cells expressing SNX1-GFP and DCFP1-RFP under starved conditions (stv., 15 min). Arrowheads indicate SNX1-GFP–positive tubules associated with DFPC1-RFP structures. Scale bars = 1 um. (B) HeLa cells expressing Sec61 beta -RFP (magenta) and DFCP1-GFP (yellow) were grown under starvation for 1 h, fixed and stained with anti-SNX1 (blue) antibodies and observed by confocal microscopy. Scale bar = 5 um. (B, C) Magnified area (×4.5) from confocal image (B), top panel, showing codistribution event between Sec61 beta -RFP (magenta), SNX1 (blue), and DFCP1-GFP (yellow) and 3D rendering view of magnified area, bottom panel, showing the surface of Sec61 beta -RFP (magenta), SNX1 (blue), and DFCP1-GFP (yellow). Scale bars = 1 um. (C, D) Quantification of SNX1 codistribution with DFCP1-GFP and Sec61 beta -RFP (ER)-positive domains per 100 um2 as illustrated in (C). Means +/- SEM, from three independent experiments; ***P < 0.001 in unpaired two-tailed t test. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36585258), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for SNX1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Western Blot
0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SNX1
Alternate Names
HsT17379, MGC8664, SNX1Asorting nexin 1A, sorting nexin 1, sorting nexin-1, Vps5
Gene Symbol
SNX1
Additional SNX1 Products
Product Documents for SNX1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SNX1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for SNX1 Antibody - BSA Free
Customer Reviews for SNX1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SNX1 Antibody - BSA Free and earn rewards!
Have you used SNX1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...