Sonic Hedgehog/Shh Antibody (8T4D3)

Novus Biologicals | Catalog # NBP3-15454

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8T4D3 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Sonic Hedgehog/Shh (Q15465). PGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Sonic Hedgehog/Shh Antibody (8T4D3)

Western Blot: Sonic Hedgehog/Shh Antibody (8T4D3) [NBP3-15454]

Western Blot: Sonic Hedgehog/Shh Antibody (8T4D3) [NBP3-15454]

Western Blot: Sonic Hedgehog/Shh Antibody (8T4D3) [NBP3-15454] - Analysis of extracts of various cell lines, using Sonic Hedgehog/Shh (Shh) Rabbit mAb (NBP3-15454) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: Sonic Hedgehog/Shh Antibody (8T4D3) [NBP3-15454]

Immunocytochemistry/ Immunofluorescence: Sonic Hedgehog/Shh Antibody (8T4D3) [NBP3-15454]

Immunocytochemistry/Immunofluorescence: Sonic Hedgehog/Shh Antibody (8T4D3) [NBP3-15454] - Immunofluorescence analysis of Hep G2 cells using Sonic Hedgehog/Shh (Shh) Rabbit mAb (NBP3-15454) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: Sonic Hedgehog/Shh Antibody (8T4D3) [NBP3-15454]

Western Blot: Sonic Hedgehog/Shh Antibody (8T4D3) [NBP3-15454]

Western Blot: Sonic Hedgehog/Shh Antibody (8T4D3) [NBP3-15454] - Analysis of extracts of various cell lines, using Sonic Hedgehog/Shh (Shh) Rabbit mAb (NBP3-15454) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Sonic Hedgehog/Shh Antibody (8T4D3)

Immunocytochemistry/ Immunofluorescence: Sonic Hedgehog/Shh Antibody (8T4D3) [Sonic Hedgehog/Shh] -

Immunocytochemistry/ Immunofluorescence: Sonic Hedgehog/Shh Antibody (8T4D3) [Sonic Hedgehog/Shh] - Confocal imaging of paraffin-embedded Mouse kidney using Sonic Hedgehog/Shh Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Sonic Hedgehog/Shh Antibody (8T4D3)

Immunocytochemistry/ Immunofluorescence: Sonic Hedgehog/Shh Antibody (8T4D3) [Sonic Hedgehog/Shh] -

Immunocytochemistry/ Immunofluorescence: Sonic Hedgehog/Shh Antibody (8T4D3) [Sonic Hedgehog/Shh] - Confocal imaging of Hep G2 cells using Sonic Hedgehog/Shh Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for Sonic Hedgehog/Shh Antibody (8T4D3)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Sonic Hedgehog/Shh

Sonic Hedgehog Protein (SHH, VHH-1) belongs to hedgehog protein family which includes Indian Hh, and Desert Hh. Hh family is involved in the cell fate and patterning during embryonic development, homeostasis, and adult tissue renewal (1). Similar to other member in the family, SHH binds to the patched (PTC) cell surface receptor, releasing the signal transducer Smoothened (Smo) to transmit the Hh signal into the cell and activate transcription of the target gene (2). Precursor SHH is autocatlytically cleaved into two subunits, N-terminal and C-terminal products. Soluble N-terminal product is involved in the signaling activity, while C-product displays an autoproteolysis activity on the precursor and a cholesterol transferase activity on the N-terminal product. C-terminal product attaches a cholesterol moiety to the N-terminal product, preventing N-terminal product diffusion within the developing embryo (3). A defect in SHH has been linked in holoprosencephaly type 3 (HPE3), in which developing forebrain fails to separate into right and left hemispheres, and ocular coloboma (4).

Alternate Names

HHG1, HLP3, HPE3, MCOPCB5, Shh, ShhNC, SMMCI, TPTPS

Gene Symbol

SHH

Additional Sonic Hedgehog/Shh Products

Product Documents for Sonic Hedgehog/Shh Antibody (8T4D3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Sonic Hedgehog/Shh Antibody (8T4D3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Sonic Hedgehog/Shh Antibody (8T4D3)

There are currently no reviews for this product. Be the first to review Sonic Hedgehog/Shh Antibody (8T4D3) and earn rewards!

Have you used Sonic Hedgehog/Shh Antibody (8T4D3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies