SRp55 Antibody (5G6) - Azide and BSA Free

Novus Biologicals | Catalog # H00006431-M02

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 5G6

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SFRS6 (NP_006266, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRR

Specificity

SFRS6 - splicing factor, arginine/serine-rich 6 (5G6)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for SRp55 Antibody (5G6) - Azide and BSA Free

Western Blot: SRp55 Antibody (5G6) [H00006431-M02]

Western Blot: SRp55 Antibody (5G6) [H00006431-M02]

Western Blot: SRp55 Antibody (5G6) [H00006431-M02] - Analysis of SFRS6 expression in transfected 293T cell line by SFRS6 monoclonal antibody (M02), clone 5G6.Lane 1: SFRS6 transfected lysate(39.6 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: SRp55 Antibody (5G6) [H00006431-M02]

Immunocytochemistry/ Immunofluorescence: SRp55 Antibody (5G6) [H00006431-M02]

Immunocytochemistry/Immunofluorescence: SRp55 Antibody (5G6) [H00006431-M02] - Analysis of monoclonal antibody to SFRS6 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: SRp55 Antibody (5G6) [H00006431-M02] - Detection limit for recombinant GST tagged SFRS6 is approximately 0.3ng/ml as a capture antibody.

Applications for SRp55 Antibody (5G6) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SRp55

The protein encoded by this gene is involved in mRNA splicing and may play a role in the determination of alternative splicing. The encoded nuclear protein belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.

Alternate Names

B52, FLJ08061, pre-mRNA splicing factor SRP55, Pre-mRNA-splicing factor SRP55, serine/arginine-rich splicing factor 6, SFRS6, Splicing factor, arginine/serine-rich 6MGC5045, splicing factor, arginine/serine-rich, 55 kDa, SR splicing factor 6, SRP55arginine/serine-rich splicing factor 6

Entrez Gene IDs

6431 (Human)

Gene Symbol

SRSF6

Additional SRp55 Products

Product Documents for SRp55 Antibody (5G6) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SRp55 Antibody (5G6) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SRp55 Antibody (5G6) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SRp55 Antibody (5G6) - Azide and BSA Free and earn rewards!

Have you used SRp55 Antibody (5G6) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...