Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse
Applications
Knockout Validated, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen for this antibody is STRA8 - C-terminal region (NP_872295). Peptide sequence PEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDED. The peptide sequence for this immunogen was taken from within the described region.
Reactivity Notes
Mouse reactivity reported from a verified customer review as well as in-house test results.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for STRA8 Antibody - BSA Free
Western Blot: STRA8 Antibody [NBP1-98492]
Western Blot: STRA8 Antibody [NBP1-98492] - Human Lung lysate. Antibody at 1.0 ug/mL.Immunocytochemistry: STRA8 Antibody [NBP1-98492]
Immunocytochemistry: STRA8 Antibody [NBP1-98492] - Adult mouse testis. ICC image submitted by a verified customer review.Applications for STRA8 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Application Notes
STRA8 Antibody validated for ICC from a verified customer review. STRA8 Antibody validated for KO from a verified customer review.
Reviewed Applications
Read 3 reviews rated 5 using NBP1-98492 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: STRA8
Alternate Names
stimulated by retinoic acid gene 8 homolog (mouse), stimulated by retinoic acid gene 8 protein homolog
Entrez Gene IDs
346673 (Human)
Gene Symbol
STRA8
UniProt
Additional STRA8 Products
Product Documents for STRA8 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for STRA8 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for STRA8 Antibody - BSA Free (3)
5 out of 5
3 Customer Ratings
Have you used STRA8 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
3 的
3 reviews
Showing All
Filter By:
-
Application: Western BlotSample Tested: Human testisSpecies: HumanVerified Customer | Posted 08/05/2020Sorted huamn germ cell treat with actA and actA+SB 24 hours. Protein collected for stra8 WB.
-
Application: Western BlotSample Tested: germ cellsSpecies: MouseVerified Customer | Posted 11/11/2019
-
Application: ImmunocytochemistrySample Tested: Adult testisSpecies: MouseVerified Customer | Posted 10/09/2019
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...