SUPT16H Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35888

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 520-695 of human SUPT16H (SPT16) (NP_009123.1).

Sequence:
KEPHIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFYCPGSALGRNEGNIFPNPEATFVKEITYRASNIKAPGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

120 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SUPT16H Antibody - BSA Free

SUPT16H Antibody

Immunocytochemistry/ Immunofluorescence: SUPT16H Antibody [NBP3-35888] -

Immunocytochemistry/ Immunofluorescence: SUPT16H Antibody [NBP3-35888] - Immunofluorescence analysis of NIH/3T3 cells using SUPT16H(SPT16) Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SUPT16H Antibody

Immunocytochemistry/ Immunofluorescence: SUPT16H Antibody [NBP3-35888] -

Immunocytochemistry/ Immunofluorescence: SUPT16H Antibody [NBP3-35888] - Immunofluorescence analysis of U2OS cells using SUPT16H(SPT16) Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SUPT16H Antibody

Western Blot: SUPT16H Antibody [NBP3-35888] -

Western Blot: SUPT16H Antibody [NBP3-35888] - Western Blot analysis of various lysates using SUPT16H Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates / proteins: 25 ug per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for SUPT16H Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SUPT16H

Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may facilitate access to DNA. One such factor, FACT (facilitates chromatin transcription), interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT is composed of an 80 kDa subunit and a 140 kDa subunit; this gene encodes the 140 kDa subunit. (provided by RefSeq)

Alternate Names

CDC68, Chromatin-specific transcription elongation factor 140 kDa subunit, facilitates chromatin remodeling 140 kDa subunit, Facilitates chromatin transcription complex subunit SPT16, FACT 140 kDa subunit, FACT complex subunit SPT16, FACT140, FACTp140, FACTP140FACT, FLJ10857, FLJ14010, FLJ34357, hSPT16, SPT16/CDC68, suppressor of Ty (S.cerevisiae) 16 homolog, suppressor of Ty 16 homolog (S. cerevisiae)

Gene Symbol

SUPT16H

Additional SUPT16H Products

Product Documents for SUPT16H Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SUPT16H Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SUPT16H Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SUPT16H Antibody - BSA Free and earn rewards!

Have you used SUPT16H Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...