TBK1 Antibody (4G6C7)

Novus Biologicals | Catalog # NBP3-16189

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4G6C7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TBK1 (Q9UHD2). MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TBK1 Antibody (4G6C7)

Western Blot: TBK1 Antibody (4G6C7) [NBP3-16189]

Western Blot: TBK1 Antibody (4G6C7) [NBP3-16189]

Western Blot: TBK1 Antibody (4G6C7) [NBP3-16189] - Western blot analysis of extracts of various cell lines, using TBK1 Rabbit mAb (NBP3-16189) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Western Blot: TBK1 Antibody (4G6C7) [NBP3-16189]

Western Blot: TBK1 Antibody (4G6C7) [NBP3-16189]

Western Blot: TBK1 Antibody (4G6C7) [NBP3-16189] - Western blot analysis of extracts of various cell lines, using TBK1 Rabbit mAb (NBP3-16189) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Immunoprecipitation: TBK1 Antibody (4G6C7) [NBP3-16189]

Immunoprecipitation: TBK1 Antibody (4G6C7) [NBP3-16189]

Immunoprecipitation: TBK1 Antibody (4G6C7) [NBP3-16189] - Immunoprecipitation analysis of 300ug extracts of 293T cells using 3ug TBK1 antibody (NBP3-16189). Western blot was performed from the immunoprecipitate using TBK1 antibody (NBP3-16189) at a dilition of 1:1000.
TBK1 Antibody (4G6C7)

Immunocytochemistry/ Immunofluorescence: TBK1 Antibody (4G6C7) [NBP3-16189] -

Immunocytochemistry/ Immunofluorescence: TBK1 Antibody (4G6C7) [NBP3-16189] - Confocal imaging of MCF7 cells using TBK1 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
TBK1 Antibody (4G6C7)

Immunocytochemistry/ Immunofluorescence: TBK1 Antibody (4G6C7) [NBP3-16189] -

Immunocytochemistry/ Immunofluorescence: TBK1 Antibody (4G6C7) [NBP3-16189] - Confocal imaging of NIH/3T3 cells using TBK1 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Applications for TBK1 Antibody (4G6C7)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:100 - 1:800

Immunoprecipitation

0.5μg-4μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:1000 - 1:4000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TBK1

NFkappaB-activating kinase (NAK) also known as TANK binding kinase-1 (TBK1) or tumor necrosis factor receptor associated factor 2-associated kinase (T2K) is a serine/threonine protein that belongs to the IkB kinase (IKK) family (1). Similar to IKK alpha and beta (2), NAK induces IkB degradation and NF-kB activity. NAK is activated by phorbol ester tumour promoters and growth factors, whereas catalytically inactive NAK specifically inhibits activation of NF-kB by protein kinase C-epsilon (PKCepsilon). NAK specifically phosphorylates IkB alpha on Serine 36 and NFkB subunit RelA (p65) on Serine 536 (3). NAK is also known to interact with TANK, TRAF-2 and TRIF (4).

Long Name

TANK Binding Kinase 1

Alternate Names

FTDALS4, NAK, NFKB-Activating Kinase

Gene Symbol

TBK1

Additional TBK1 Products

Product Documents for TBK1 Antibody (4G6C7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TBK1 Antibody (4G6C7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TBK1 Antibody (4G6C7)

There are currently no reviews for this product. Be the first to review TBK1 Antibody (4G6C7) and earn rewards!

Have you used TBK1 Antibody (4G6C7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TBK1 Antibody (4G6C7)

Showing  1 - 56 FAQs Showing All
  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

Showing  1 - 56 FAQs Showing All
View all FAQs for Antibodies
Loading...