Thyrotropin Releasing Hormone Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94348

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 143-242 of human Thyrotropin Releasing Hormone (NP_009048.1). WLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Thyrotropin Releasing Hormone Antibody - Azide and BSA Free

Western Blot: Thyrotropin Releasing Hormone AntibodyAzide and BSA Free [NBP2-94348]

Western Blot: Thyrotropin Releasing Hormone AntibodyAzide and BSA Free [NBP2-94348]

Western Blot: Thyrotropin Releasing Hormone Antibody [NBP2-94348] - Analysis of extracts of various cell lines, using Thyrotropin Releasing Hormone at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Thyrotropin Releasing Hormone Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Thyrotropin Releasing Hormone Antibody - Azide and BSA Free [NBP2-94348] -

Immunocytochemistry/ Immunofluorescence: Thyrotropin Releasing Hormone Antibody - Azide and BSA Free [NBP2-94348] - Immunofluorescence analysis of U2OS cells using Thyrotropin Releasing Hormone Rabbit pAb (A14472) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Thyrotropin Releasing Hormone Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Thyrotropin Releasing Hormone Antibody - Azide and BSA Free [NBP2-94348] -

Immunocytochemistry/ Immunofluorescence: Thyrotropin Releasing Hormone Antibody - Azide and BSA Free [NBP2-94348] - Immunofluorescence analysis of H9C2 cells using Thyrotropin Releasing Hormone Rabbit pAb (A14472) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: Thyrotropin Releasing Hormone Antibody - Azide and BSA Free [NBP2-94348]

Immunocytochemistry/ Immunofluorescence: Thyrotropin Releasing Hormone Antibody - Azide and BSA Free [NBP2-94348]

Immunocytochemistry/Immunofluorescence: Thyrotropin Releasing Hormone Antibody [NBP2-94348] - Analysis of L929 cells using TRH Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for Thyrotropin Releasing Hormone Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Thyrotropin Releasing Hormone

Functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems.

Alternate Names

MGC125964, MGC125965, prothyroliberin, thyrotropin-releasing hormone

Gene Symbol

TRH

Additional Thyrotropin Releasing Hormone Products

Product Documents for Thyrotropin Releasing Hormone Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Thyrotropin Releasing Hormone Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Thyrotropin Releasing Hormone Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Thyrotropin Releasing Hormone Antibody - Azide and BSA Free and earn rewards!

Have you used Thyrotropin Releasing Hormone Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...