TMSB4Y Antibody (6G4) - Azide and BSA Free

Novus Biologicals | Catalog # H00009087-M05

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 6G4

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

TMSB4Y (NP_004193.1, 1 a.a. ~ 44 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for TMSB4Y Antibody (6G4) - Azide and BSA Free

Western Blot: TMSB4Y Antibody (6G4) [H00009087-M05]

Western Blot: TMSB4Y Antibody (6G4) [H00009087-M05]

Western Blot: TMSB4Y Antibody (6G4) [H00009087-M05] - Analysis of TMSB4Y expression in transfected 293T cell line by TMSB4Y monoclonal antibody (M05), clone 6G4. Lane 1: TMSB4Y transfected lysatE (5 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: TMSB4Y Antibody (6G4) [H00009087-M05]

Immunocytochemistry/ Immunofluorescence: TMSB4Y Antibody (6G4) [H00009087-M05]

Immunocytochemistry/Immunofluorescence: TMSB4Y Antibody (6G4) [H00009087-M05] - Analysis of monoclonal antibody to TMSB4Y on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: TMSB4Y Antibody (6G4) [H00009087-M05] - Detection limit for recombinant GST tagged TMSB4Y is 0.1 ng/ml as a capture antibody.

Applications for TMSB4Y Antibody (6G4) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is useful for ELISA, Western Blot

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: TMSB4Y

The TMSB4Y gene lies within the male specific region of chromosome Y. Its homolog on chromosome X escapes X inactivation and encodes an actin sequestering protein. [provided by RefSeq]

Alternate Names

MGC26307, TB4Ythymosin, beta 4, Y chromosome, thymosin beta 4, Y-linked, thymosin beta-4, Y isoform, thymosin beta-4, Y-chromosomal

Gene Symbol

TMSB4Y

Additional TMSB4Y Products

Product Documents for TMSB4Y Antibody (6G4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TMSB4Y Antibody (6G4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TMSB4Y Antibody (6G4) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review TMSB4Y Antibody (6G4) - Azide and BSA Free and earn rewards!

Have you used TMSB4Y Antibody (6G4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...