TRIM8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89776

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Western Blot, Flow Cytometry

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QDIEDQLYKLESDKRLVEEKVNQLKEEVRLQYEKLHQLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TRIM8 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TRIM8 Antibody [NBP1-89776]

Immunocytochemistry/ Immunofluorescence: TRIM8 Antibody [NBP1-89776]

Immunocytochemistry/Immunofluorescence: TRIM8 Antibody [NBP1-89776] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles.
TRIM8 Antibody - BSA Free Immunohistochemistry-Paraffin: TRIM8 Antibody - BSA Free [NBP1-89776]

Immunohistochemistry-Paraffin: TRIM8 Antibody - BSA Free [NBP1-89776]

Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry: TRIM8 Antibody [NBP1-89776]

Immunohistochemistry: TRIM8 Antibody [NBP1-89776]

GERP-Antibody-Immunohistochemistry-NBP1-89776-img0008.jpg
TRIM8 Antibody

Flow Cytometry: TRIM8 Antibody [NBP1-89776] -

Flow Cytometry: TRIM8 Antibody [NBP1-89776] - Knockdown of TRIM8 promotes differentiation & impairs GBM stemness & self‐renewal capacity. (A) Western blot analysis shows reduced CD133, NESTIN, SOX2, & c‐MYC, & upregulated GFAP in GBM neurosphere cells following TRIM8 knockdown by TRIM8 shRNA1 or TRIM8 shRNA2. NT shRNA = nontargeting control shRNA. Western blot also shows upregulated PIAS3 & reduced phosphorylated STAT3 (Tyr705) following shRNA knockdown of TRIM8. (B) ICC shows reduced expression of TRIM8 (red), NESTIN (white), & SOX2 (red) in TRIM8 shRNA1‐knockdown cells compared to NT shRNA cells. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. (C) Flow cytometric analysis & statistical analysis of SOX2 expression in TRIM8‐overexpressing neurosphere cells. SOX2 was tagged by APC (blue: 676 nm) with TRIM8 tagged by PE (red: 555 nm). ***P < 0.001, ****P < 0.0001. Statistics: Data are means ± SD (n = 3), by nonparametric t‐test. (D,E) TRIM8 knockdown impairs neurosphere formation. Representative images of neurosphere expressing NT shRNA & TRIM8 shRNA1 at specific time points are shown. Scale bar = 30 μm. Statistical analysis of average sphere size: by one‐way analysis of variance (ANOVA). Data are means ± standard deviation (SD) (n = 6). **P < 0.01, ***P < 0.001, ****P < 0.0001. (F) Western blot analysis shows reduced TRIM8 & activated STAT3 (Tyr705), with increased GFAP expression following differentiation induced by serum. (G) ICC reveals reduced TRIM8 (red) & increased GFAP (white) after four days of differentiation induced by serum. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TRIM8 Antibody

Flow Cytometry: TRIM8 Antibody [NBP1-89776] -

Flow Cytometry: TRIM8 Antibody [NBP1-89776] - Ectopic expression of TRIM8 enhances stemness & self‐renewal of GBM‐derived neurospheres. (A) Western blot analysis shows upregulation of CD133, NESTIN, SOX2, & c‐MYC following ectopic expression of TRIM8‐GFP fusion protein. WB also shows reduced PIAS3 & increased phosphorylated STAT3 (Tyr705) & total STAT3 following TRIM8 overexpression. (B) ICC staining of TRIM8 (red) with stem cell markers NESTIN (white), & SOX2 (red) in neurosphere cells overexpressing TRIM8. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. (C) Flow cytometric analysis & statistical analysis showing CD133 & SOX2 upregulation in neurosphere cells with TRIM8 overexpression. CD133 was tagged by PE (red: 555 nm) with TRIM8 tagged by APC (blue: 676 nm). SOX2 was tagged by APC (blue: 676 nm) with TRIM8 tagged by PE (red: 555 nm). ***P < 0.001, ****P < 0.0001. Statistics: Data are means ± SD (n = 3), by nonparametric t‐test. (D,E) Effects of TRIM8 overexpression on neurosphere formation. Representative images of neurospheres expressing GFP vector or TRIM8‐GFP vector at specific points. Scale bar = 30 μm. Statistical analysis of average sphere size: by one‐way analysis of variance (ANOVA). Data are means ± standard deviation (SD) (n = 6). **P < 0.01, ***P < 0.001, ****P < 0.0001. (F) Extreme limiting dilution assay (ELDA) shows that TRIM8 overexpression reduces the cell dose required for colony formation, supporting enhanced stem cell properties. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Knockdown Validated: TRIM8 Antibody [NBP1-89776]

Immunocytochemistry/ Immunofluorescence: TRIM8 Antibody [NBP1-89776]

GERP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89776-img0007.jpg
TRIM8 Antibody

Immunocytochemistry/ Immunofluorescence: TRIM8 Antibody [NBP1-89776] -

Immunocytochemistry/ Immunofluorescence: TRIM8 Antibody [NBP1-89776] - TRIM8 is expressed in GBM samples & neurosphere cells. (A–C) Gene expression correlation of TRIM8 with STAT3,SOX2, & NESTIN using U133 mRNA data from TCGA. TRIM8 vs STAT3: Pearson's correlation coefficient: r = 0.36, P < 0.00001. TRIM8 vs SOX2: Pearson's correlation coefficient: r = 0.22, P < 0.00001. TRIM8 vs NESTIN: Pearson's correlation coefficient: r = 0.22, P < 0.00001. (D) Schematic representation of TRIM8 protein with RING, B‐box, & coiled‐coil domains. (E) TRIM8 copy number variation among 577 GBM samples in TCGA dataset. TRIM8 shows hemizygous deletion in 88.04% of cases. (F) Western blot analysis of TRIM8 protein among six normal human brain tissues (N1–N6) & five GBMs (G1–G5). (G) Immunohistochemical (IHC) staining of TRIM8 in normal brain & GBM tissues. TRIM8 (+) cells (indicated by arrow) are predominantly neurons in the normal brain & show cytoplasmic staining. TRIM8 expression in GBM is predominant in nuclei of tumor cells with modest cytoplasmic staining. Sections were counterstained with hematoxylin. Scale bar = 10 μm. (H) Reverse transcription PCR analysis & western blot analysis of TRIM8 among two normal cell lines & six patient‐derived GBM neurosphere cells. NHNP = normal human neural progenitor cell. (I) Immunocytochemical (ICC) staining of TRIM8 in neurosphere cells showing nuclear expression of TRIM8. TRIM8 was labeled in GFP, & nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TRIM8 Antibody

Immunocytochemistry/ Immunofluorescence: TRIM8 Antibody [NBP1-89776] -

Immunocytochemistry/ Immunofluorescence: TRIM8 Antibody [NBP1-89776] - Ectopic expression of TRIM8 enhances stemness & self‐renewal of GBM‐derived neurospheres. (A) Western blot analysis shows upregulation of CD133, NESTIN, SOX2, & c‐MYC following ectopic expression of TRIM8‐GFP fusion protein. WB also shows reduced PIAS3 & increased phosphorylated STAT3 (Tyr705) & total STAT3 following TRIM8 overexpression. (B) ICC staining of TRIM8 (red) with stem cell markers NESTIN (white), & SOX2 (red) in neurosphere cells overexpressing TRIM8. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. (C) Flow cytometric analysis & statistical analysis showing CD133 & SOX2 upregulation in neurosphere cells with TRIM8 overexpression. CD133 was tagged by PE (red: 555 nm) with TRIM8 tagged by APC (blue: 676 nm). SOX2 was tagged by APC (blue: 676 nm) with TRIM8 tagged by PE (red: 555 nm). ***P < 0.001, ****P < 0.0001. Statistics: Data are means ± SD (n = 3), by nonparametric t‐test. (D,E) Effects of TRIM8 overexpression on neurosphere formation. Representative images of neurospheres expressing GFP vector or TRIM8‐GFP vector at specific points. Scale bar = 30 μm. Statistical analysis of average sphere size: by one‐way analysis of variance (ANOVA). Data are means ± standard deviation (SD) (n = 6). **P < 0.01, ***P < 0.001, ****P < 0.0001. (F) Extreme limiting dilution assay (ELDA) shows that TRIM8 overexpression reduces the cell dose required for colony formation, supporting enhanced stem cell properties. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TRIM8 Antibody - BSA Free

Immunohistochemistry: TRIM8 Antibody - BSA Free [NBP1-89776] -

TRIM8 is expressed in GBM samples and neurosphere cells. (A–C) Gene expression correlation of TRIM8 with STAT3,SOX2, and NESTIN using U133 mRNA data from TCGA. TRIM8 vs STAT3: Pearson's correlation coefficient: r = 0.36, P < 0.00001. TRIM8 vs SOX2: Pearson's correlation coefficient: r = 0.22, P < 0.00001. TRIM8 vs NESTIN: Pearson's correlation coefficient: r = 0.22, P < 0.00001. (D) Schematic representation of TRIM8 protein with RING, B‐box, and coiled‐coil domains. (E) TRIM8 copy number variation among 577 GBM samples in TCGA dataset. TRIM8 shows hemizygous deletion in 88.04% of cases. (F) Western blot analysis of TRIM8 protein among six normal human brain tissues (N1–N6) and five GBMs (G1–G5). (G) Immunohistochemical (IHC) staining of TRIM8 in normal brain and GBM tissues. TRIM8 (+) cells (indicated by arrow) are predominantly neurons in the normal brain and show cytoplasmic staining. TRIM8 expression in GBM is predominant in nuclei of tumor cells with modest cytoplasmic staining. Sections were counterstained with hematoxylin. Scale bar = 10 μm. (H) Reverse transcription PCR analysis and western blot analysis of TRIM8 among two normal cell lines and six patient‐derived GBM neurosphere cells. NHNP = normal human neural progenitor cell. (I) Immunocytochemical (ICC) staining of TRIM8 in neurosphere cells showing nuclear expression of TRIM8. TRIM8 was labeled in GFP, and nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for TRIM8 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIM8

TRIM8 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to nuclear bodies. Its structure is similar to some tumor suppressor proteins and its gene maps to a locus thought to contain tumor suppressor genes.

Alternate Names

EC 6.3.2.-, GERP, GERPRING finger protein 27glioblastoma expressed ring finger protein, Glioblastoma-expressed RING finger protein, RNF27probable E3 ubiquitin-protein ligase TRIM8, tripartite motif containing 8, tripartite motif protein TRIM8, tripartite motif-containing 8, Tripartite motif-containing protein 8

Entrez Gene IDs

81603 (Human)

Gene Symbol

TRIM8

UniProt

Additional TRIM8 Products

Product Documents for TRIM8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRIM8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TRIM8 Antibody - BSA Free

Customer Reviews for TRIM8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRIM8 Antibody - BSA Free and earn rewards!

Have you used TRIM8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...