VE-Cadherin Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-21223

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for VE-Cadherin Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: VE-Cadherin Antibody [NBP3-21223] -

Immunocytochemistry/Immunofluorescence: VE-Cadherin Antibody [NBP3-21223] -

Immunocytochemistry/Immunofluorescence: VE-Cadherin Antibody [NBP3-21223] - Staining of human cell line EFO-21 shows localization to nucleoplasm, nuclear membrane & plasma membrane.
Western Blot: VE-Cadherin Antibody [NBP3-21223] -

Western Blot: VE-Cadherin Antibody [NBP3-21223] -

Western Blot: VE-Cadherin Antibody [NBP3-21223] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil

Applications for VE-Cadherin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VE-Cadherin

VE-cadherin (cadherin-5) is an endothelial specific adhesion molecule that is essential for the maintenance of endothelial barrier function and angiogenesis. VE-cadherin is linked to the actin cytoskeleton through a number of adaptor proteins including a-, â-, and ã-catenin. Cytoskeletal dynamics and phosphorylation regulate VE-cadherin mediated cell-cell adhesion. The cytosolic C-terminal Src kinase (Csk) binds via its SH2 domain to the phosphorylated tyrosine 658 site of VE-cadherin. This interaction regulates density dependent cell proliferation. Phosphorylation of tyrosine 658 has also been shown to lead to the uncoupling of p120-catenin from the cytoplasmic tail of VE-cadherin. This phosphorylation event is sufficient to maintain cells in a mesenchymal state during the cell invasion phase of angiogenesis.

Long Name

Vascular Endothelium Cadherin

Alternate Names

Cadherin-5, CD144, CDH5, VECadherin

Gene Symbol

CDH5

Additional VE-Cadherin Products

Product Documents for VE-Cadherin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VE-Cadherin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VE-Cadherin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VE-Cadherin Antibody - BSA Free and earn rewards!

Have you used VE-Cadherin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies