14-3-3 beta/alpha Antibody (2F7O1)

Novus Biologicals | Catalog # NBP3-16768

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2F7O1 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 147-246 of human 14-3-3 beta/alpha (P31946). SQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 14-3-3 beta/alpha Antibody (2F7O1)

Western Blot: 14-3-3 beta/alpha Antibody (2F7O1) [NBP3-16768]

Western Blot: 14-3-3 beta/alpha Antibody (2F7O1) [NBP3-16768]

Western Blot: 14-3-3 beta/alpha Antibody (2F7O1) [NBP3-16768] - Western blot analysis of extracts of various cell lines, using 14-3-3 beta/alpha Rabbit mAb (NBP3-16768) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Applications for 14-3-3 beta/alpha Antibody (2F7O1)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: 14-3-3 beta/alpha

The 14-3-3 proteins are a family of proteins involved in the regulation of apoptosis, mitogenic signaling and cell-cycle checkpoints. The 14-3-3 proteins are thought to be key regulators of signal transduction events mediated through their binding to serine-phosphorylated proteins. Through binding Bad, 14-3-3 prevents apoptosis by sequestering Bad to the cytosol.

Alternate Names

14-3-3 alpha, 14-3-3 beta, 14-3-3 protein beta/alpha, brain protein 14-3-3, beta isoform, GW128, HS1, KCIP-1, Protein 1054, Protein kinase C inhibitor protein 1, protein kinase C inhibitor protein-1, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, alphapolypeptide, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, betapolypeptide, YWHAA

Gene Symbol

YWHAB

Additional 14-3-3 beta/alpha Products

Product Documents for 14-3-3 beta/alpha Antibody (2F7O1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 14-3-3 beta/alpha Antibody (2F7O1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 14-3-3 beta/alpha Antibody (2F7O1)

There are currently no reviews for this product. Be the first to review 14-3-3 beta/alpha Antibody (2F7O1) and earn rewards!

Have you used 14-3-3 beta/alpha Antibody (2F7O1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...