14-3-3 epsilon Antibody (4X6E1)

Novus Biologicals | Catalog # NBP3-16515

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4X6E1 expressed in HEK293
View all 14-3-3 epsilon Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 epsilon (P62258). MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 14-3-3 epsilon Antibody (4X6E1)

Western Blot: 14-3-3 epsilon Antibody (4X6E1) [NBP3-16515]

Western Blot: 14-3-3 epsilon Antibody (4X6E1) [NBP3-16515]

Western Blot: 14-3-3 epsilon Antibody (4X6E1) [NBP3-16515] - Western blot analysis of extracts of various cell lines, using 14-3-3 epsilon Rabbit mAb (NBP3-16515) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Applications for 14-3-3 epsilon Antibody (4X6E1)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: 14-3-3 epsilon

14-3-3 epsilon product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer.

Alternate Names

1433 epsilon, YWHAE

Gene Symbol

YWHAE

Additional 14-3-3 epsilon Products

Product Documents for 14-3-3 epsilon Antibody (4X6E1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for 14-3-3 epsilon Antibody (4X6E1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 14-3-3 epsilon Antibody (4X6E1)

There are currently no reviews for this product. Be the first to review 14-3-3 epsilon Antibody (4X6E1) and earn rewards!

Have you used 14-3-3 epsilon Antibody (4X6E1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies