53BP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58677

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all 53BP2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TISVPSYPSKSASVTASSESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDNSPNLQNNPEEPNPEAPHVLDVYLE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 53BP2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: 53BP2 Antibody [NBP2-58677]

Immunocytochemistry/ Immunofluorescence: 53BP2 Antibody [NBP2-58677]

Immunocytochemistry/Immunofluorescence: 53BP2 Antibody [NBP2-58677] - Staining of human cell line U-251 MG shows localization to cytosol & cell junctions.

Applications for 53BP2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 53BP2

53BP2 encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. It is localized to the perinuclear region of the cytoplasm, and regulates apoptosis and cell growth through interactions with other regulatory molecules including members of the p53 family. Multiple transcript variants encoding different isoforms have been found for this gene.

Alternate Names

apoptosis-stimulating protein of p53, 2, ASPP2P53BP2,53BP2apoptosis-stimulating of p53 protein 2, Bbp, Bcl2-binding protein, p53-binding protein 2, p53BP2, PPP1R13A, Renal carcinoma antigen NY-REN-51, tumor protein p53 binding protein, 2, tumor protein p53-binding protein, 2, Tumor suppressor p53-binding protein 2

Gene Symbol

TP53BP2

Additional 53BP2 Products

Product Documents for 53BP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for 53BP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 53BP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 53BP2 Antibody - BSA Free and earn rewards!

Have you used 53BP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies