60S ribosomal protein L23 Antibody (2F12) - Azide and BSA Free

Novus Biologicals | Catalog # H00009349-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 2F12

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

RPL23 (AAH34378, 1 a.a. ~ 77 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKKGE

Specificity

RPL23 - ribosomal protein L23 (2F12)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Scientific Data Images for 60S ribosomal protein L23 Antibody (2F12) - Azide and BSA Free

Western Blot: 60S ribosomal protein L23 Antibody (2F12) [H00009349-M01]

Western Blot: 60S ribosomal protein L23 Antibody (2F12) [H00009349-M01]

Western Blot: 60S ribosomal protein L23 Antibody (2F12) [H00009349-M01] - Detection against Immunogen (34.21 KDa).

Applications for 60S ribosomal protein L23 Antibody (2F12) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: 60S ribosomal protein L23

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L14P family of ribosomal proteins. It is located in the cytoplasm. This gene has been referred to as rpL17 because the encoded protein shares amino acid identity with ribosomal protein L17 from Saccharomyces cerevisiae; however, its official symbol is RPL23. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq]

Alternate Names

MGC111167, MGC117346, MGC72008,60S ribosomal protein L17,60S ribosomal protein L23, ribosomal protein L17, ribosomal protein L23, rpL17

Entrez Gene IDs

9349 (Human)

Gene Symbol

RPL23

Additional 60S ribosomal protein L23 Products

Product Documents for 60S ribosomal protein L23 Antibody (2F12) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 60S ribosomal protein L23 Antibody (2F12) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 60S ribosomal protein L23 Antibody (2F12) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review 60S ribosomal protein L23 Antibody (2F12) - Azide and BSA Free and earn rewards!

Have you used 60S ribosomal protein L23 Antibody (2F12) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...