ACOX3 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15513

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human ACOX3 (NP_001095137). TALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKTIFSALENDPLFARSPGADLSLEKYRELNFLRCKRIFEYDFLSVEDMFKSP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACOX3 Antibody - Azide and BSA Free

ACOX3 Antibody - Azide and BSA Free

Western Blot: ACOX3 Antibody - Azide and BSA Free [NBP3-15513] -

Western Blot: ACOX3 Antibody - Azide and BSA Free [NBP3-15513] - Western blot analysis of lysates from MCF7 cells using ACOX3 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: ACOX3 Antibody - Azide and BSA Free [NBP3-15513]

Immunocytochemistry/ Immunofluorescence: ACOX3 Antibody - Azide and BSA Free [NBP3-15513]

Immunocytochemistry/Immunofluorescence: ACOX3 Antibody [NBP3-15513] - Immunofluorescence analysis of C6 cells using ACOX3 antibody (NBP3-15513) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: ACOX3 Antibody - Azide and BSA Free [NBP3-15513]

Immunocytochemistry/ Immunofluorescence: ACOX3 Antibody - Azide and BSA Free [NBP3-15513]

Immunocytochemistry/Immunofluorescence: ACOX3 Antibody [NBP3-15513] - Immunofluorescence analysis of U-2 OS cells using ACOX3 antibody (NBP3-15513) at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for ACOX3 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ACOX3

ACOX3, also known as Peroxisomal acyl-coenzyme A oxidase 3, consists of a 78 kDa and a shorter 70 kDa isoform, and is involved in the oxidation of 2-methyl-branched fatty acids in CoA-esters. Disease research is currently being conducted with ACOX3 and its relation to prostate cancer, prostatitis, and leukemia. This protein has been shown to have interactions with SMURF2, SLC2A4, ACAA1, ACAA2, and ACAT1 in the PPAR signaling pathway and a variety of metabolic pathways including those of peroxisomal lipids, lipoproteins, and fatty acids.

Alternate Names

acyl-CoA oxidase 3, pristanoyl, Branched-chain acyl-CoA oxidase, BRCACox, BRCOX, EC 1.3.3.6, peroxisomal acyl-coenzyme A oxidase 3, PRCOX, pristanoyl, Pristanoyl-CoA oxidase

Gene Symbol

ACOX3

Additional ACOX3 Products

Product Documents for ACOX3 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ACOX3 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for ACOX3 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ACOX3 Antibody - Azide and BSA Free and earn rewards!

Have you used ACOX3 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...