ACRBP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84387

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ACRBP Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ACRBP. Peptide sequence: KVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ACRBP Antibody - BSA Free

Western Blot: ACRBP Antibody [NBP2-84387]

Western Blot: ACRBP Antibody [NBP2-84387]

Western Blot: ACRBP Antibody [NBP2-84387] - Host: Rabbit. Target Name: ACRBP. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: ACRBP Antibody [NBP2-84387]

Western Blot: ACRBP Antibody [NBP2-84387]

Western Blot: ACRBP Antibody [NBP2-84387] - Host: Rabbit. Target Name: ACRBP. Sample Tissue: Human PANC1 Whole Cell. Antibody Dilution: 1ug/ml

Applications for ACRBP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACRBP

ACRBP is encoded by this gene is similar to proacrosin binding protein sp32 precursor found in mouse, guinea pig, and pig. This protein is located in the sperm acrosome and is thought to function as a binding protein to proacrosin for packaging and condensation of the acrosin zymogen in the acrosomal matrix. This protein is a member of the cancer/testis family of antigens and it is found to be immunogenic. In normal tissues, this mRNA is expressed only in testis, whereas it is detected in a range of different tumor types such as bladder, breast, lung, liver, and colon. [provided by RefSeq]

Alternate Names

acrosin binding protein, acrosin-binding protein, Cancer/testis antigen 23, Cancer/testis antigen OY-TES-1, CT23FLJ51160, OY-TES-1, proacrosin binding protein sp32, Proacrosin-binding protein sp32, SP32

Gene Symbol

ACRBP

Additional ACRBP Products

Product Documents for ACRBP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ACRBP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACRBP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACRBP Antibody - BSA Free and earn rewards!

Have you used ACRBP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies