actin, gamma 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83925

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human actin, gamma 2. Peptide sequence: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for actin, gamma 2 Antibody - BSA Free

Western Blot: actin, gamma 2 Antibody [NBP2-83925]

Western Blot: actin, gamma 2 Antibody [NBP2-83925]

Western Blot: actin, gamma 2 Antibody [NBP2-83925] - WB Suggested Anti-ACTG2 Antibody. Titration: 0.25 ug/ml. Positive Control: Fetal Lung

Applications for actin, gamma 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: actin, gamma 2

All eukaryotic cells express actin, which often constitutes as much as 50% of total cellular protein. Actin filaments can form both stable and labile structures and are crucial components of microvilli and the contractile apparatus of muscle cells. While lower eukaryotes, such as yeast, have only one actin gene, higher eukaryotes have several isoforms encoded by a family of genes. At least six types of actin are present in mammalian tissues and fall into three classes. alpha actin expression is limited to various types of muscle, whereas beta and gamma are the principle constituents of filaments in other tissues. Members of the small GTPase family regulate the organization of the actin cytoskeleton. Rho controls the assembly of actin stress fibers and focal adhesion, Rac regulates actin filament accumulation at the plasma membrane and Cdc42 stimulates formation of filopodia.

Alternate Names

ACT, ACTA3alpha-actin 3, ACTE, actin, gamma 2, smooth muscle, enteric, actin, gamma-enteric smooth muscle, ACTL3, ACTSGactin-like protein, Alpha-actin-3, Gamma-2-actin, smooth muscle gamma actin, Smooth muscle gamma-actin

Gene Symbol

ACTG2

Additional actin, gamma 2 Products

Product Documents for actin, gamma 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for actin, gamma 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for actin, gamma 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review actin, gamma 2 Antibody - BSA Free and earn rewards!

Have you used actin, gamma 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...